DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and mgc108380

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001027480.1 Gene:mgc108380 / 613072 -ID:- Length:384 Species:Xenopus tropicalis


Alignment Length:351 Identity:127/351 - (36%)
Similarity:199/351 - (56%) Gaps:20/351 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LRSEKAFLANRYGFSFAKSSGTATLKNTANMEYTCKMNIGTPKQKFTVLPDTGSSNIWVPGPHCK 182
            :::.|...|.:|.|:.......|......:..|..:::||||.|.|.||.||||||:|||...|:
 Frog    42 MKTHKRDPALKYHFNEKYDFAVAYEPMYMDTYYYGEISIGTPPQNFLVLFDTGSSNLWVPSTSCQ 106

  Fly   183 SKACKKHKQYHPAKSSTYVKNGKSFAITYGSGSVAGVLAKDTVRIAGLVVTNQTFAMTTKEPGTT 247
            |:||..|..::|::||||..||:.|:::||||||.||...|||.:.||.:.||.|.:|..|.|::
 Frog   107 SEACSNHNLFNPSQSSTYTSNGQQFSMSYGSGSVTGVFGYDTVTVQGLSLNNQEFGLTYTESGSS 171

  Fly   248 FVTSNFDGILGLGYRSIAVDNVKTLVQNMCSEDVITSCKFAICMKGGGSSSRGGAIIFGSSNTSA 312
            |..|.||||.|:.|.:::.....|.:|.|..::::|...|::.|     ||:.|.:|||..:.:.
 Frog   172 FYYSKFDGIFGMAYPAMSAGGATTAMQGMLQQNLLTYPIFSVYM-----SSQSGEVIFGGVDNNL 231

  Fly   313 YSGSNSYTYTPVTKKGYWQFTLQDIYVGGTKV---SGSVQAIVDSGTSLITAPTAIYNKINKVIG 374
            |||  ...::|||::.|||..:.:..:.|...   |...|||||:|||.:|.|......:.:.:|
 Frog   232 YSG--QIQWSPVTQEVYWQIGIDEFLINGQATGWCSQGCQAIVDTGTSPLTIPQQYMGTLLQNLG 294

  Fly   375 CRATSSGECWMKC--AKKIPDFTFVIAGKKFVVKGNKMKLKVRTNRGRTVCISAVTEVPD---EP 434
            .: ..:|...:.|  .:.:|..||||.|.:|.:..:  ...|:||...||.:.. |.:|.   :|
 Frog   295 AQ-NYNGMFVVNCNSVQNLPTITFVINGVQFPIPPS--GYIVQTNGYCTVGVEE-TYLPSQNGQP 355

  Fly   435 V-ILGDAFIRHFCTEFDLANNRIGFA 459
            : ||||.|:|.:.:.:|::|||:|||
 Frog   356 LWILGDVFLRQYYSVYDMSNNRVGFA 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 120/325 (37%)
Asp 149..460 CDD:278455 122/320 (38%)
mgc108380NP_001027480.1 A1_Propeptide 17..45 CDD:369623 0/2 (0%)
pepsin_retropepsin_like 71..383 CDD:386101 122/322 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13683
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.