DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and REN

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_000528.1 Gene:REN / 5972 HGNCID:9958 Length:406 Species:Homo sapiens


Alignment Length:385 Identity:118/385 - (30%)
Similarity:191/385 - (49%) Gaps:33/385 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LPLD---FQQNFVRTTDNLR---SEKAFLANRYGFSFAKSSGTATLKNTA---------NMEYTC 152
            ||.|   |::.|::...::|   .|:.....|.|..:::.....||.||.         :.:|..
Human    24 LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYG 88

  Fly   153 KMNIGTPKQKFTVLPDTGSSNIWVPGPHCKS--KACKKHKQYHPAKSSTYVKNGKSFAITYGSGS 215
            ::.||||.|.|.|:.||||||:|||...|..  .||..||.:..:.||:|..||....:.|.:|:
Human    89 EIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGT 153

  Fly   216 VAGVLAKDTVRIAGLVVTNQTFAMTTKEPGTTFVTSNFDGILGLGYRSIAVDNVKTLVQNMCSED 280
            |:|.|::|.:.:.|:.|| |.|...|:.|...|:.:.|||::|:|:...|:..|..:..|:.|:.
Human   154 VSGFLSQDIITVGGITVT-QMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQG 217

  Fly   281 VITSCKFAICMK--GGGSSSRGGAIIFGSSNTSAYSGSNSYTYTPVTKKGYWQFTLQDIYVGGTK 343
            |:....|:....  ...|.|.||.|:.|.|:...|.|  ::.|..:.|.|.||..::.:.||.:.
Human   218 VLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEG--NFHYINLIKTGVWQIQMKGVSVGSST 280

  Fly   344 V--SGSVQAIVDSGTSLITAPTAIYNKINKVIGCRATSSGECWMKC--AKKIPDFTFVIAGKKFV 404
            :  .....|:||:|.|.|:..|:...|:.:.:|.:.... :..:||  ...:||.:|.:.||::.
Human   281 LLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLF-DYVVKCNEGPTLPDISFHLGGKEYT 344

  Fly   405 VKGNKMKLKVRTNRGRTVCISAVTEV----PDEPV-ILGDAFIRHFCTEFDLANNRIGFA 459
            :.......: .:...:.:|..|:..:    |..|. .||..|||.|.||||..|||||||
Human   345 LTSADYVFQ-ESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFA 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 106/338 (31%)
Asp 149..460 CDD:278455 105/324 (32%)
RENNP_000528.1 A1_Propeptide 33..>51 CDD:311771 3/17 (18%)
renin_like 78..405 CDD:133154 105/331 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.