DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and Cym

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_064476.2 Gene:Cym / 56825 RGDID:708486 Length:379 Species:Rattus norvegicus


Alignment Length:343 Identity:121/343 - (35%)
Similarity:180/343 - (52%) Gaps:23/343 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 NRYGFSFAKSS----GTATLKNTANMEYTCKMNIGTPKQKFTVLPDTGSSNIWVPGPHCKSKACK 187
            ::|.||...|:    .:..|.|..:.||...:.:|||.|:|.|:.|||||.:|||..:|.||.|:
  Rat    47 HQYEFSEKNSNIGVVASEPLTNYLDSEYFGLIYVGTPPQEFKVVFDTGSSELWVPSVYCSSKVCR 111

  Fly   188 KHKQYHPAKSSTYVKNGKSFAITYGSGSVAGVLAKDTVRIAGLVVTNQTFAMTTKEPGTTFVTSN 252
            .|.::.|:||.|:....|...:.||:|||.|.||.|||.::.:||.:||..::|:|||..|..|.
  Rat   112 NHNRFDPSKSFTFQNLSKPLFVQYGTGSVEGFLAYDTVTVSDIVVPHQTVGLSTEEPGDIFTYSP 176

  Fly   253 FDGILGLGYRSIAVDNVKTLVQNMCSEDVITSCKFAICMKGGGSSSRGGAIIFGSSNTSAYSGSN 317
            |||||||.|.:.|......:..||.:..::....|::.|   ..:.:|..:..|:.:.|.:.|  
  Rat   177 FDGILGLAYPTFASKYSVPIFDNMMNRHLVAQDLFSVYM---SRNDQGSMLTLGAIDQSYFIG-- 236

  Fly   318 SYTYTPVTKKGYWQFTLQDIYVGGTKVS--GSVQAIVDSGTSLITAP----TAIYNKINKVIGCR 376
            |..:.|||.:||||||:..|.:....|:  |...|::|:||:|:|.|    ..|.:.|..|.|..
  Rat   237 SLHWVPVTVQGYWQFTVDRITINDEVVACQGGCPAVLDTGTALLTGPGRDILNIQHAIGAVQGQH 301

  Fly   377 ATSSGECWMKCAKKIPDFTFVIAGKKFVVKGNKMKLKVRTNRGRTVCISAVTEVPDEPVILGDAF 441
            .....:||.  ...:|...|.|.|::|     .:.....||:.:..|.|.... ..:..||||.|
  Rat   302 DQFDIDCWR--LNFMPTVVFEINGREF-----PLPPSAYTNQFQGSCSSGFRH-GSQMWILGDVF 358

  Fly   442 IRHFCTEFDLANNRIGFA 459
            ||.|.:.||.||||:|.|
  Rat   359 IREFYSVFDRANNRVGLA 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 116/322 (36%)
Asp 149..460 CDD:278455 115/317 (36%)
CymNP_064476.2 A1_Propeptide 19..47 CDD:400357 121/343 (35%)
pepsin_retropepsin_like 64..377 CDD:416259 117/326 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.