DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and XB964428

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_002933025.1 Gene:XB964428 / 496913 XenbaseID:XB-GENE-964429 Length:383 Species:Xenopus tropicalis


Alignment Length:343 Identity:127/343 - (37%)
Similarity:203/343 - (59%) Gaps:20/343 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 NRYGFSFAKSSGTATLKNTANMEYTCKMNIGTPKQKFTVLPDTGSSNIWVPGPHCKSKACKKHKQ 191
            |:|..:|      ..|.|..:|.|..:::||||.|.|.||.||||||:||...:|:|:||..|..
 Frog    50 NQYATAF------EPLANYMDMSYYGEISIGTPPQNFLVLFDTGSSNLWVASTNCQSQACTNHPL 108

  Fly   192 YHPAKSSTYVKNGKSFAITYGSGSVAGVLAKDTVRIAGLVVTNQTFAMTTKEPGTTFVTSNFDGI 256
            ::|::||||..|.:.|::.||:||:.|:|..|||.|..:.::.|.|.::..||||.||.:.||||
 Frog   109 FNPSQSSTYSSNQQQFSLQYGTGSLTGILGYDTVTIQNIAISQQEFGLSVTEPGTNFVYAQFDGI 173

  Fly   257 LGLGYRSIAVDNVKTLVQNMCSEDVITSCKFAICMKGGGSSSRGGAIIFGSSNTSAYSGSNSYTY 321
            |||.|.||||....|::|.|..::::....|...:.|..:.| ||.:.||..:.:.|:|  ...:
 Frog   174 LGLAYPSIAVGGATTVMQGMLQQNLLNEPVFGFYLSGENTQS-GGEVAFGGVDQNYYTG--QIYW 235

  Fly   322 TPVTKKGYWQFTLQDIYVGGTKVSG----SVQAIVDSGTSLITAPTAIYNKINKVIGCRATSSGE 382
            ||||.:.|||..:|...:.| :.||    ..|.|||:||||:|||.:|:..:.:.||.:...:||
 Frog   236 TPVTSETYWQIGIQGFSING-QASGWCSQGCQGIVDTGTSLLTAPQSIFASLMQDIGAQQDQNGE 299

  Fly   383 CWMKCA--KKIPDFTFVIAGKKFVVKGNKMKLKVRTNRGRTVCI--SAVTEVPDEPV-ILGDAFI 442
            ..:.|:  :.:|..:|.|:|..|.:..:...|: :::...|:.|  :.::....:|: ||||.|:
 Frog   300 YVVSCSSIQNLPTISFTISGVSFPLPPSAYVLQ-QSSGYCTIGIMPTYLSSQNGQPMWILGDVFL 363

  Fly   443 RHFCTEFDLANNRIGFAA 460
            |.:.:.:||.||::|||:
 Frog   364 RQYYSVYDLGNNQVGFAS 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 122/325 (38%)
Asp 149..460 CDD:278455 120/319 (38%)
XB964428XP_002933025.1 A1_Propeptide 17..>36 CDD:369623
pepsin_retropepsin_like 64..382 CDD:386101 122/323 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.