DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and ren

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_998025.1 Gene:ren / 405786 ZFINID:ZDB-GENE-040630-3 Length:395 Species:Danio rerio


Alignment Length:337 Identity:106/337 - (31%)
Similarity:178/337 - (52%) Gaps:17/337 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 SSGTA--TLKNTANMEYTCKMNIGTPKQKFTVLPDTGSSNIWVPGPHCKS--KACKKHKQYHPAK 196
            ::|||  .|.|..:.:|..:::||:|.|.|.|:.||||:|:|||...|..  .||..|.:|..:|
Zfish    60 TNGTAPTPLINYLDTQYFGEISIGSPAQMFNVVFDTGSANLWVPSHSCSPLYTACFTHNRYDASK 124

  Fly   197 SSTYVKNGKSFAITYGSGSVAGVLAKDTVRIAGLVVTNQTFAMTTKEPGTTFVTSNFDGILGLGY 261
            |.|::.||..|:|.|.||:|.|.|::|.|.:.|:.|. |.||..|..|...|:.:.|||:||:||
Zfish   125 SLTHIFNGTGFSIQYASGNVRGFLSEDVVVVGGIPVV-QVFAEATALPAIPFILAKFDGVLGMGY 188

  Fly   262 RSIAVDNVKTLVQNMCSEDVITSCKFAICMKGGGSSSRGGAIIFGSSNTSAYSGSNSYTYTPVTK 326
            .::|:|.:..:...:.|:.|:....|::......:...||.::.|.::.:.::|  .:.|....:
Zfish   189 PNVAIDGITPVFDRIMSQHVLKENVFSVYYSRDPTHIPGGELVLGGTDPNYHTG--PFHYINTKE 251

  Fly   327 KGYWQFTLQDIYVGGTKV--SGSVQAIVDSGTSLITAPTAIYNKINKVIGCRATSSGECWMKC-- 387
            :|.|:..::.:.||...:  .....|::|:|:|.||.|.:..:.:.|.||....:.|...:.|  
Zfish   252 QGKWEVIMKGVSVGADILFCKDGCTAVIDTGSSYITGPASSISILMKTIGAVELAEGGYTVSCNV 316

  Fly   388 AKKIPDFTFVIAGKKFVVKGNKMKLKVRTNRGRTVCISAVTEV----PDEPV-ILGDAFIRHFCT 447
            .:.:|...|.:.|:::.:......| .::..|..:|......:    |..|| |||..||..:.|
Zfish   317 VRLLPTVAFHLGGQEYSLTDEDYIL-WQSEFGEDICTVTFKALDVPPPTGPVWILGANFIARYYT 380

  Fly   448 EFDLANNRIGFA 459
            |||..|||||||
Zfish   381 EFDRGNNRIGFA 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 101/327 (31%)
Asp 149..460 CDD:278455 101/322 (31%)
renNP_998025.1 A1_Propeptide 23..>38 CDD:285240
renin_like 68..394 CDD:133154 103/329 (31%)
Asp 75..394 CDD:278455 101/322 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.