DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and CG31928

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001259869.1 Gene:CG31928 / 326175 FlyBaseID:FBgn0051928 Length:418 Species:Drosophila melanogaster


Alignment Length:424 Identity:127/424 - (29%)
Similarity:195/424 - (45%) Gaps:56/424 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SRNQRKR-RLNAAKRSRRKRNLARKSNRKIRAKTESIVRSDSSYATLPLDFQQNFVRTTDNLRSE 121
            ||..||. :|...:.:...:.|:...|:|:|.|.:....||.:.:::.:                
  Fly    26 SRRWRKSVQLKLHRETNHTKILSSFHNQKLRLKEKLSPTSDLAISSVSV---------------- 74

  Fly   122 KAFLANRYGFSFAKSSGTATLKNTANMEYTCKMNIGTPK-QKFTVLPDTGSSNIWVPGPHCKSKA 185
                   |..:.:|.:    |.|:.|.||......|||| |..|:|.||.|:|:.|.......::
  Fly    75 -------YQTTVSKEN----LINSHNTEYYVTAGFGTPKSQPVTLLVDTASANLLVYSSEFVKQS 128

  Fly   186 CKKHKQYHPAKSSTYVKNGKSFAITYGSGSV-AGVLAKDTVRIAGLVVTNQTFAMTTKEPGTTFV 249
            |..|..|:.::|.||..||..|.|.:.|..: .|:|:.||..:..||:.|||||.....|.....
  Fly   129 CLHHDGYNSSESQTYQANGSPFQIQFASQEILTGILSTDTFTLGDLVIKNQTFAEINSAPTDMCK 193

  Fly   250 TSNFDGILGLGYRSIAVDNVKTLVQNMCSEDVITSCKFAICM-KGGGSSSRGGAIIFGSSNTSAY 313
            .||||||:|||:..||::.|:|.:.|:..:.:|....|::.: :....:|.||.::.|.|:.:.|
  Fly   194 RSNFDGIIGLGFSEIALNGVETPLDNILEQGLIDEPIFSLYVNRNASDASNGGVLLLGGSDPTLY 258

  Fly   314 SGSNSYTYTPVTKKGYWQFTLQDIYVGGTKVSGSVQAIVDSGTSLITAPTAIYNKINKVIGCRAT 378
            ||  ..||.||:|.|:||.|:..:.:|..|:..:.|||.|.|||||..|......|||.:|.:.|
  Fly   259 SG--CLTYVPVSKVGFWQITVGQVEIGSKKLCSNCQAIFDMGTSLIIVPCPALKIINKKLGIKET 321

  Fly   379 --SSGECWMKCAK--KIPDFTFVIAGKKFVVKGNKMKLKVRTNRGRTVCISAVTEVPD------- 432
              ..|...:.|.|  .:|...|.|..|.|.:..:...|    |...| |:|..:.:.|       
  Fly   322 DRKDGVYIIDCKKVSHLPKIVFNIGWKDFTLNPSDYIL----NYSGT-CVSGFSSLSDCNGTQTN 381

  Fly   433 ---EPV----ILGDAFIRHFCTEFDLANNRIGFA 459
               |.:    :.||.|.....|.||.....:|.|
  Fly   382 DDSEDLNNIWVFGDVFFGAIFTLFDFGLKLVGMA 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 112/337 (33%)
Asp 149..460 CDD:278455 110/332 (33%)
CG31928NP_001259869.1 pepsin_retropepsin_like 84..416 CDD:299705 113/339 (33%)
Asp 91..416 CDD:278455 110/332 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439960
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1684
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.