DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and Bace1

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_062077.1 Gene:Bace1 / 29392 RGDID:2191 Length:501 Species:Rattus norvegicus


Alignment Length:399 Identity:102/399 - (25%)
Similarity:156/399 - (39%) Gaps:86/399 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NFVRTTDNLRSEKAFLANRYGFSFAKSSGTATLKNTANMEYTCKMNIGTPKQKFTVLPDTGSSNI 174
            :||...||||.:               ||..         |..:|.:|:|.|...:|.||||||.
  Rat    59 SFVEMVDNLRGK---------------SGQG---------YYVEMTVGSPPQTLNILVDTGSSNF 99

  Fly   175 WV---PGPHCKSKACKKHKQYHPAKSSTYVKNGKSFAITYGSGSVAGVLAKDTVRIA-GLVVTNQ 235
            .|   |.|..       |:.|....||||....||..:.|..|...|.|..|.|.|. |..||.:
  Rat   100 AVGAAPHPFL-------HRYYQRQLSSTYRDLRKSVYVPYTQGKWEGELGTDLVSIPHGPNVTVR 157

  Fly   236 TFAMTTKEPGTTFVT-SNFDGILGLGYRSIA--VDNVKTLVQNMCSEDVITSCKFAICMKGGG-- 295
            .......|....|:. ||::|||||.|..||  .|:::....::..:..|.:. |::.:.|.|  
  Rat   158 ANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHIPNI-FSLQLCGAGFP 221

  Fly   296 ------SSSRGGAIIFGSSNTSAYSGSNSYTYTPVTKKGYWQFTLQDIYVGG------TKVSGSV 348
                  .:|.||::|.|..:.|.|:|  |..|||:.::.|::..:..:.:.|      .|.....
  Rat   222 LNQTEALASVGGSMIIGGIDHSLYTG--SLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYD 284

  Fly   349 QAIVDSGTSLITAPTAIYNKINKVIGCRATSSGE-------------CWMKCAKK---IPDFTFV 397
            ::||||||:.:..|..::....|.|  :|.||.|             ||......   .|..:..
  Rat   285 KSIVDSGTTNLRLPKKVFEAAVKSI--KAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLY 347

  Fly   398 IAGKKFVVKGNKMKLKVRTNR----------GRTVCISAVTEVPDEPVILGDAFIRHFCTEFDLA 452
            :.|:   |.....::.:...:          .:..|............::|...:..|...||.|
  Rat   348 LMGE---VTNQSFRITILPQQYLRPVEDVATSQDDCYKFAVSQSSTGTVMGAVIMEGFYVVFDRA 409

  Fly   453 NNRIGFAAT 461
            ..|||||.:
  Rat   410 RKRIGFAVS 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 92/363 (25%)
Asp 149..460 CDD:278455 93/357 (26%)
Bace1NP_062077.1 beta_secretase_like 72..437 CDD:133140 95/371 (26%)
Interaction with RTN3. /evidence=ECO:0000250 479..501
DXXLL. /evidence=ECO:0000250|UniProtKB:P56817 496..500
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.