DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and asp-16

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_741674.1 Gene:asp-16 / 260226 WormBaseID:WBGene00012682 Length:395 Species:Caenorhabditis elegans


Alignment Length:386 Identity:114/386 - (29%)
Similarity:194/386 - (50%) Gaps:48/386 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 RTTDNLRSE-------KAFLANRYGFSFAK-SSGTATLKNTANMEYTCKMNIGTPKQKFTVLPDT 169
            ::|.:||::       :.|||:::.....: ::|:..|.:..:..|...:.:|||.|..:|:.||
 Worm    23 KSTGSLRAKLIQAGKYQEFLASQHAARLQQLNTGSQPLIDYYDDMYLANITVGTPPQPASVVLDT 87

  Fly   170 GSSNIWVPGPHCKSKACKKH-------KQYHPAKSSTYVKNGKSFAITYGSGSVAGVLAKDTVRI 227
            .|:|:||....|.|:||..:       ::::|.||||:||..:.|:|.||||:.:|.|..|.:::
 Worm    88 ASANLWVIDAACNSQACNGNPGSGYTKQKFNPNKSSTFVKGTRRFSIQYGSGTSSGYLGTDVLQL 152

  Fly   228 AGLVVTNQTFAMTTKEPGTTFVTSNFDGILGLGYRSIAVDNVKTLVQNMCSEDVITSCKFAICM- 291
            .||.|..|.|.:.| ..|:...:...|||.|||:.:|:||.|...:||:.|:..:.:..|:|.: 
 Worm   153 GGLTVKAQEFGVAT-NLGSVLGSEPMDGIFGLGWPAISVDQVTPPMQNLISQKQLDAPLFSIWVD 216

  Fly   292 ------KGGGSSSRGGAIIFGSSNTSAYSGSNSYTYTPVTKKGYWQFTLQDIYVGGTKVSGSVQA 350
                  :||    .||.|.:|:.:|.  :......|..::.|.||||.:..:.:|...:....||
 Worm   217 RKLQVSQGG----TGGLITYGAVDTK--NCDAQVNYVALSSKTYWQFPMDGVAIGNYAMMKQEQA 275

  Fly   351 IVDSGTSLITAPTAIYNKINKVIGCRATSSGECW------MKCA--KKIPDFTFVIAGKKFVVKG 407
            |.|:|::.:..|..:.|.|     .:.|.:...|      :.|:  :..||..|.|.|.::.||.
 Worm   276 ISDTGSAWLGLPNPVLNAI-----VQQTKATYDWNYEIYTLDCSTMQTQPDLVFTIGGMQYPVKS 335

  Fly   408 NKMKLKVRTNRGRTVCISAVTEVPD----EPVILGDAFIRHFCTEFDLANNRIGFAATTYS 464
            .:..|.:....||  |:.|:....:    ...:||..|||.||..:|:.|.|||||...:|
 Worm   336 IEYILDLGLGNGR--CVLAMLSYSNTGFGPSYVLGHVFIRQFCNVYDIGNARIGFANAHHS 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 104/342 (30%)
Asp 149..460 CDD:278455 104/336 (31%)
asp-16NP_741674.1 Asp 68..391 CDD:365818 105/336 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162082
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D270366at33208
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.