DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and Ren2

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_112470.2 Gene:Ren2 / 19702 MGIID:97899 Length:424 Species:Mus musculus


Alignment Length:343 Identity:119/343 - (34%)
Similarity:182/343 - (53%) Gaps:20/343 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 FAKSS------GTATLKNTANMEYTCKMNIGTPKQKFTVLPDTGSSNIWVPGPHCKS--KACKKH 189
            |.|.|      ....|.|..|.:|..::.||||.|.|.|:.||||:|:|||...|..  .||..|
Mouse    83 FTKRSSLTDLISPVVLTNYLNSQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIH 147

  Fly   190 KQYHPAKSSTYVKNGKSFAITYGSGSVAGVLAKDTVRIAGLVVTNQTFAMTTKEPGTTFVTSNFD 254
            ..|..:.||:|::||..|.|.||||.|.|.|::|:|.:.|:.|| |||...|:.|...|:.:.||
Mouse   148 SLYESSDSSSYMENGDDFTIHYGSGRVKGFLSQDSVTVGGITVT-QTFGEVTELPLIPFMLAQFD 211

  Fly   255 GILGLGYRSIAVDNVKTLVQNMCSEDVITSCKFAICMKGGGSSSRGGAIIFGSSNTSAYSGSNSY 319
            |:||:|:.:.||..|..:..::.|:.|:....|:: ....|....||.::.|.|:...|.|  .:
Mouse   212 GVLGMGFPAQAVGGVTPVFDHILSQGVLKEKVFSV-YYNRGPHLLGGEVVLGGSDPEHYQG--DF 273

  Fly   320 TYTPVTKKGYWQFTLQDIYVGGTKV--SGSVQAIVDSGTSLITAPTAIYNKINKVIGCRATSSGE 382
            .|..::|...||.|::.:.||.:.:  ....:.:||:|:|.|:|||:....|.:.:|.:.....|
Mouse   274 HYVSLSKTDSWQITMKGVSVGSSTLLCEEGCEVVVDTGSSFISAPTSSLKLIMQALGAKEKRLHE 338

  Fly   383 CWMKCAK--KIPDFTFVIAGKKFVVKGNKMKLKVRTNRGR--TVCISAV-TEVPDEPV-ILGDAF 441
            ..:.|::  .:||.:|.:.|:.:.:......|:....|.:  ||.:.|: ...|..|| :||..|
Mouse   339 YVVSCSQVPTLPDISFNLGGRAYTLSSTDYVLQYPNRRDKLCTVALHAMDIPPPTGPVWVLGATF 403

  Fly   442 IRHFCTEFDLANNRIGFA 459
            ||.|.||||..|||||||
Mouse   404 IRKFYTEFDRHNNRIGFA 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 114/326 (35%)
Asp 149..460 CDD:278455 113/321 (35%)
Ren2NP_112470.2 A1_Propeptide 51..76 CDD:285240
renin_like 98..423 CDD:133154 116/328 (35%)
Asp 105..423 CDD:278455 113/321 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.