DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and CTSD

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001900.1 Gene:CTSD / 1509 HGNCID:2529 Length:412 Species:Homo sapiens


Alignment Length:340 Identity:135/340 - (39%)
Similarity:188/340 - (55%) Gaps:25/340 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LKNTANMEYTCKMNIGTPKQKFTVLPDTGSSNIWVPGPHCK--SKACKKHKQYHPAKSSTYVKNG 204
            |||..:.:|..::.||||.|.|||:.||||||:|||..|||  ..||..|.:|:..|||||||||
Human    71 LKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNG 135

  Fly   205 KSFAITYGSGSVAGVLAKDTVRI-----------AGLVVTNQTFAMTTKEPGTTFVTSNFDGILG 258
            .||.|.|||||::|.|::|||.:           .|:.|..|.|...||:||.||:.:.||||||
Human   136 TSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILG 200

  Fly   259 LGYRSIAVDNVKTLVQNMCSEDVITSCKFAICMKGGGSSSRGGAIIFGSSNTSAYSGSNSYTYTP 323
            :.|..|:|:||..:..|:..:.::....|:..:.....:..||.::.|.:::..|.||.|  |..
Human   201 MAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLS--YLN 263

  Fly   324 VTKKGYWQFTLQDIYV--GGTKVSGSVQAIVDSGTSLITAPTAIYNKINKVIGCRATSSGECWMK 386
            ||:|.|||..|..:.|  |.|......:||||:||||:..|.....::.|.||......||..:.
Human   264 VTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIP 328

  Fly   387 CAK--KIPDFTFVIAGKKFVVKGNKMKLKVRTNRGRTVCISAVTEV----PDEPV-ILGDAFIRH 444
            |.|  .:|..|..:.||.:.:......||| :..|:|:|:|....:    |..|: ||||.||..
Human   329 CEKVSTLPAITLKLGGKGYKLSPEDYTLKV-SQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGR 392

  Fly   445 FCTEFDLANNRIGFA 459
            :.|.||..|||:|||
Human   393 YYTVFDRDNNRVGFA 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 133/338 (39%)
Asp 149..460 CDD:278455 132/333 (40%)
CTSDNP_001900.1 A1_Propeptide 22..49 CDD:400357
Cathepsin_D2 73..408 CDD:133157 133/338 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.