DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and LOC100493461

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_002938556.2 Gene:LOC100493461 / 100493461 -ID:- Length:402 Species:Xenopus tropicalis


Alignment Length:357 Identity:123/357 - (34%)
Similarity:195/357 - (54%) Gaps:18/357 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LRSEKAFLANRY------GFSFAKSSGTATLKNTANMEYTCKMNIGTPKQKFTVLPDTGSSNIWV 176
            |..:....|.:|      .:|.|..:.|..|.:..|.:|..::::|||.|.|:|:.||||||.||
 Frog    43 LHHQPHIFARKYTQCFPPPYSLAAGTTTEYLVDYMNAQYYGEISVGTPPQNFSVVFDTGSSNFWV 107

  Fly   177 PGPHCKSKACKKHKQYHPAKSSTYVKNGKSFAITYGSGSVAGVLAKDTVRIAGLVVTNQTFAMTT 241
            |..:|.|:||:.|:::...:|::|...|:.|:|.||:|.:.||..:||:||:.:.:..|.|..:.
 Frog   108 PSSYCLSEACQVHERFKSFESTSYEHGGRPFSIHYGTGQLVGVTGRDTLRISNMSIEGQDFGESI 172

  Fly   242 KEPGTTFVTSNFDGILGLGYRSIAVDNVKTLVQNMCSEDVITSCKFAICMKGGGSSSRGGAIIFG 306
            .|||.|||.:.|||:|||||.|:||.....:...:.::.::....|:..:.....|..||.:|||
 Frog   173 LEPGRTFVLAQFDGVLGLGYPSLAVAGAVPVFDRIVNQKLVEQQLFSFHLNRDYDSEYGGELIFG 237

  Fly   307 SSNTSAYSGSNSYTYTPVTKKGYWQFTLQDIYVGGTKV--SGSVQAIVDSGTSLITAPTAIYNKI 369
            ..:.|.|.|  ...:.|:|:|||||..|.::.|.|..:  ..|.|.||||||||||.|.|...|:
 Frog   238 GIDHSLYKG--QIHWIPLTEKGYWQIRLDNVKVDGEAMFCQSSCQVIVDSGTSLITGPKAEIKKL 300

  Fly   370 NKVIGCRATSSGECWMKCAK--KIPDFTFVIAGKKFVVKGNKMKLKVRTNRGRTVCISAV----T 428
            .:::|...|..||..:.|::  .:|..||.|..:.:.:...:..:|.|:.:. ..|::..    .
 Frog   301 QELLGATPTLFGEYILDCSRVSSLPRVTFTIGQRDYTLTPEQYTIKERSQKS-DFCLTGFQAMDI 364

  Fly   429 EVPDEPV-ILGDAFIRHFCTEFDLANNRIGFA 459
            ...|.|: ||||.|:..|.:.||..::|||.|
 Frog   365 STKDGPLWILGDIFMSKFYSVFDREHDRIGLA 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 116/325 (36%)
Asp 149..460 CDD:278455 115/320 (36%)
LOC100493461XP_002938556.2 A1_Propeptide 17..45 CDD:400357 1/1 (100%)
pepsin_retropepsin_like 75..397 CDD:416259 116/325 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.