DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17283 and LOC100489782

DIOPT Version :9

Sequence 1:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_002933028.1 Gene:LOC100489782 / 100489782 -ID:- Length:383 Species:Xenopus tropicalis


Alignment Length:403 Identity:132/403 - (32%)
Similarity:204/403 - (50%) Gaps:67/403 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 TESIVRSDSSYATLPL----DFQQNFVRT---TDNLRSEKAFLANRYGFSFAKSSGTATLKNTAN 147
            :|.:||       :||    ..:||....   ...|::.|..|::||       .|.|.:..:..
 Frog    14 SEGLVR-------VPLMKSKSIRQNMAEAGVLDKYLQTHKIDLSSRY-------RGYAVVTESMY 64

  Fly   148 ME--YTCKMNIGTPKQKFTVLPDTGSSNIWVPGPHCKSKACKKHKQYHPAKSSTYVKNGKSFAIT 210
            .:  |...::||||.|.|.||.||||||:|||..:|:|.||..|..:.|::||||..||:.|.:.
 Frog    65 FDTYYYGPISIGTPPQNFLVLFDTGSSNLWVPSSYCQSSACTNHNVFKPSQSSTYSSNGQKFTMG 129

  Fly   211 YGSGSVA----GVLAKDTVRIAGLVVTNQTFAMTTKEPGTTFVTSNFDGILGLGYRSIAVDNVKT 271
            ||.|:||    |:...|||.|.|:.:|||.|.:|..||.:.|..|.|||||||.|..::|:..:|
 Frog   130 YGGGNVASSVTGLFGYDTVSIQGISITNQEFGLTITEPTSNFYYSPFDGILGLAYPGLSVEGAQT 194

  Fly   272 LVQNMCSEDVITSCKFAICMKGGGSSSRGGAIIFGSSNTSAYSGSNSYTYTPVTKKGYWQFTLQD 336
            ::|.|..|:::....|:|.:     .|:.|.||||..:::.|:|  ...:.|::::.|||..||:
 Frog   195 VLQGMMQENLLNPSMFSIYL-----GSQSGEIIFGGVDSNLYTG--QIYWAPLSQELYWQVALQE 252

  Fly   337 IYVGGTKV---SGSVQAIVDSGTSLITAPTAIYNKINKVIGCRATSSGECWMKC--AKKIPDFTF 396
            ..:.|...   |...|||||:||:.:..|.....|:...:|.: |.:|..::.|  .:.:|..:|
 Frog   253 FSINGQATGWCSQGCQAIVDTGTTQLNIPQTYLTKLLPYLGIQ-TQNGGYYVNCNNLQNLPTLSF 316

  Fly   397 VIAGKKFVVK-------------GNKMKLKVRTNRGRTVCISAVTEVPDEPV-ILGDAFIRHFCT 447
            .|.|..|.:.             .|.:.|.:....|             :|: ||||.|:|.:.:
 Frog   317 TINGVSFPLPPSAYIIQENGYCYANFLNLSLPAQNG-------------QPLWILGDVFLRQYYS 368

  Fly   448 EFDLANNRIGFAA 460
            .||..||:||||:
 Frog   369 VFDYGNNQIGFAS 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 116/341 (34%)
Asp 149..460 CDD:278455 117/335 (35%)
LOC100489782XP_002933028.1 A1_Propeptide 17..45 CDD:369623 7/34 (21%)
pepsin_retropepsin_like 66..381 CDD:386101 117/335 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13683
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.