DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sur-8 and MFHAS1

DIOPT Version :10

Sequence 1:NP_001262665.1 Gene:Sur-8 / 42093 FlyBaseID:FBgn0038504 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_004216.2 Gene:MFHAS1 / 9258 HGNCID:16982 Length:1052 Species:Homo sapiens


Alignment Length:434 Identity:123/434 - (28%)
Similarity:190/434 - (43%) Gaps:81/434 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 LPPEIGCLVSLRNLALNENSLTSLPESLQNC-SQLKVLDLRHNKLAEIPPVIYRL-RSLTTLYLR 260
            ||..:|   .:..|.|..|.|..:||.|.:. ..|:||.||.|:.|.:||.:..| ..||.|.:.
Human    58 LPANLG---DIEALNLGNNGLEEVPEGLGSALGSLRVLVLRRNRFARLPPAVAELGHHLTELDVS 119

  Fly   261 FNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSA 325
            .||:||:..::                      :.||..|..|::|||.|..||..:|...:|..
Human   120 HNRLTALGAEV----------------------VSALRELRKLNLSHNQLPALPAQLGALAHLEE 162

  Fly   326 LDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASL 390
            ||:..|.|..:|||:..|..|..|.:.:|:|::.|..|....:::|.:|..|.:..||:. :::|
Human   163 LDVSFNRLAHLPDSLSCLSRLRTLDVDHNQLTAFPRQLLQLVALEELDVSSNRLRGLPED-ISAL 226

  Fly   391 SGLTTITLSRNQFASYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALP 455
            ..|..:.||..:..:.|.|                         |.....|..|.:..|.|.|||
Human   227 RALKILWLSGAELGTLPAG-------------------------FCELASLESLMLDNNGLQALP 266

  Fly   456 LDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRI 520
            ........:..|||::|..::.|..::.|..||.|.||.|.|..:|:.|..|.:|..|.|:.|||
Human   267 AQFSCLQRLKMLNLSSNLFEEFPAALLPLAGLEELYLSRNQLTSVPSLISGLGRLLTLWLDNNRI 331

  Fly   521 EVLPHEIGLLHELQRLILQTNQITMLPRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYIN 585
            ..||..|..|..|:.|:||.|||.:||   .|.|.|:.:.:.:                    |.
Human   332 RYLPDSIVELTGLEELVLQGNQIAVLP---DHFGQLSRVGLWK--------------------IK 373

  Fly   586 QNPGLEKLPFELALCQNLKYLNIDKCPLSTIPPEIQAGGPSLVL 629
            .|| |.:.|:|:.: :.:.|:...:..|:...|.:|   |.|.|
Human   374 DNP-LIQPPYEVCM-KGIPYIAAYQKELAHSQPAVQ---PRLKL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sur-8NP_001262665.1 leucine-rich repeat 163..184 CDD:275380
LRR 185..535 CDD:443914 99/338 (29%)
leucine-rich repeat 185..207 CDD:275380 3/8 (38%)
leucine-rich repeat 208..230 CDD:275380 7/22 (32%)
leucine-rich repeat 231..253 CDD:275380 10/22 (45%)
leucine-rich repeat 254..276 CDD:275380 7/21 (33%)
leucine-rich repeat 277..299 CDD:275380 2/21 (10%)
leucine-rich repeat 300..322 CDD:275380 9/21 (43%)
leucine-rich repeat 323..345 CDD:275380 9/21 (43%)
leucine-rich repeat 346..368 CDD:275380 6/21 (29%)
leucine-rich repeat 369..392 CDD:275380 6/22 (27%)
leucine-rich repeat 417..440 CDD:275380 1/22 (5%)
leucine-rich repeat 441..486 CDD:275380 13/44 (30%)
PPP1R42 472..617 CDD:455733 43/144 (30%)
leucine-rich repeat 487..507 CDD:275380 9/19 (47%)
leucine-rich repeat 510..532 CDD:275380 10/21 (48%)
leucine-rich repeat 556..578 CDD:275380 1/21 (5%)
leucine-rich repeat 603..626 CDD:275380 4/22 (18%)
MFHAS1NP_004216.2 LRR 27..434 CDD:443914 123/434 (28%)
Required for interaction with PPP2R2A. /evidence=ECO:0000269|PubMed:28609714 64..649 120/425 (28%)
Required for interaction with PJA2. /evidence=ECO:0000269|PubMed:28471450 64..364 106/350 (30%)
leucine-rich repeat 68..88 CDD:275380 7/19 (37%)
leucine-rich repeat 89..112 CDD:275380 10/22 (45%)
leucine-rich repeat 113..136 CDD:275380 9/44 (20%)
leucine-rich repeat 137..182 CDD:275380 18/44 (41%)
leucine-rich repeat 160..173 CDD:275380 5/12 (42%)
leucine-rich repeat 183..205 CDD:275380 6/21 (29%)
leucine-rich repeat 206..228 CDD:275380 6/22 (27%)
leucine-rich repeat 229..251 CDD:275380 6/46 (13%)
leucine-rich repeat 252..274 CDD:275380 7/21 (33%)
leucine-rich repeat 275..297 CDD:275380 6/21 (29%)
leucine-rich repeat 298..320 CDD:275380 10/21 (48%)
leucine-rich repeat 321..343 CDD:275380 10/21 (48%)
leucine-rich repeat 344..364 CDD:275380 11/22 (50%)
P-loop containing Nucleoside Triphosphate Hydrolases 409..>552 CDD:476819 2/4 (50%)
COR 660..>727 CDD:406489
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.