DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sur-8 and AT5G07910

DIOPT Version :10

Sequence 1:NP_001262665.1 Gene:Sur-8 / 42093 FlyBaseID:FBgn0038504 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_196408.2 Gene:AT5G07910 / 830685 AraportID:AT5G07910 Length:262 Species:Arabidopsis thaliana


Alignment Length:213 Identity:71/213 - (33%)
Similarity:120/213 - (56%) Gaps:12/213 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 NRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVE-LNLATNALQKLPDDIMNLQNLE 488
            |||.:      .|:.|:  :.::::.|...|.::......|. |:|..|.:..:|.:|..|.|::
plant    15 NRISR------WRSTGI--VGLRDSKLKTFPDEVIEMERAVRTLDLTHNKIADVPGEISKLINMQ 71

  Fly   489 ILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRSIGHL 553
            .|::::|:::::|..:|.|:.|::|.|:.|||..||.|:|.|..|::|.:..|.:..||.:||.|
plant    72 RLLIADNLVERLPGNLGKLQSLKVLMLDGNRISCLPDELGQLVRLEQLSISRNMLIYLPDTIGSL 136

  Fly   554 GNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALCQNLKYLNIDKCPLSTIPP 618
            .||..|:||.|.|:.|||.:||..|||.:..|.|. :|:||..|.....||.|::|...::.||.
plant   137 RNLLLLNVSNNRLKSLPESVGSCASLEEVQANDNV-VEELPASLCNLIQLKSLSLDNNQVNQIPD 200

  Fly   619 EIQAGGPSLVLQWLKMHS 636
            .:.....|  ||.|.:|:
plant   201 GLLIHCKS--LQNLSLHN 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sur-8NP_001262665.1 leucine-rich repeat 163..184 CDD:275380
LRR 185..535 CDD:443914 32/110 (29%)
leucine-rich repeat 185..207 CDD:275380
leucine-rich repeat 208..230 CDD:275380
leucine-rich repeat 231..253 CDD:275380
leucine-rich repeat 254..276 CDD:275380
leucine-rich repeat 277..299 CDD:275380
leucine-rich repeat 300..322 CDD:275380
leucine-rich repeat 323..345 CDD:275380
leucine-rich repeat 346..368 CDD:275380
leucine-rich repeat 369..392 CDD:275380
leucine-rich repeat 417..440 CDD:275380 4/14 (29%)
leucine-rich repeat 441..486 CDD:275380 9/45 (20%)
PPP1R42 472..617 CDD:455733 54/144 (38%)
leucine-rich repeat 487..507 CDD:275380 4/19 (21%)
leucine-rich repeat 510..532 CDD:275380 11/21 (52%)
leucine-rich repeat 556..578 CDD:275380 11/21 (52%)
leucine-rich repeat 603..626 CDD:275380 6/22 (27%)
AT5G07910NP_196408.2 LRR <28..>220 CDD:443914 66/192 (34%)
leucine-rich repeat 47..69 CDD:275380 7/21 (33%)
leucine-rich repeat 70..92 CDD:275380 5/21 (24%)
leucine-rich repeat 93..115 CDD:275380 11/21 (52%)
leucine-rich repeat 116..161 CDD:275380 20/44 (45%)
leucine-rich repeat 162..184 CDD:275380 8/22 (36%)
leucine-rich repeat 185..208 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.