DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sur-8 and PIRL8

DIOPT Version :10

Sequence 1:NP_001262665.1 Gene:Sur-8 / 42093 FlyBaseID:FBgn0038504 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_194335.2 Gene:PIRL8 / 828711 AraportID:AT4G26050 Length:383 Species:Arabidopsis thaliana


Alignment Length:325 Identity:96/325 - (29%)
Similarity:150/325 - (46%) Gaps:75/325 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 TAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPED-IGNCVNLSALDL 328
            ||...|.||  |:..|.|....:..|.::...|.:::.||:|:|:::.:||. :...:||.||||
plant    49 TAKEGDRRQ--NIKTLDLSGMSLASLSASSINLASISKLDLSNNNIQKIPESLVARMLNLWALDL 111

  Fly   329 QHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGL 393
            |.|:|..:|:|||.|..|..|.:..|.|.|:|.|:::|:|::|.|...|.:|:|||.:     |.
plant   112 QSNQLKTLPNSIGCLSKLKFLNVSGNYLQSLPKTIEDCRSLEELNANFNELTRLPDAI-----GF 171

  Fly   394 TTITLSRNQFASYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDI 458
                               :.||                        ||||::..|.|..||..:
plant   172 -------------------ELTN------------------------LTKLSVNSNKLVLLPNSV 193

  Fly   459 GTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVL 523
            ....::..|:...|.|..||:|:.||.||::|.:|.|.                     ..:..|
plant   194 SYLTSLRVLDARLNRLSSLPEDLENLVNLQVLNVSQNF---------------------QHLTTL 237

  Fly   524 PHEIGLLHELQRLILQTNQITMLPRSIGHLGNLTHLSVSENNLQFLPEEI--GSLESLENLYINQ 586
            |:.:|||..|..|.:..|.||:||.|:|.|..:..|||..|.|...|.|:  ..||:|:. |:::
plant   238 PYSVGLLISLVELDVSYNGITVLPDSLGCLRRIQKLSVEGNPLISPPFEVVEQGLEALKQ-YMSE 301

  Fly   587  586
            plant   302  301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sur-8NP_001262665.1 leucine-rich repeat 163..184 CDD:275380
LRR 185..535 CDD:443914 76/270 (28%)
leucine-rich repeat 185..207 CDD:275380
leucine-rich repeat 208..230 CDD:275380
leucine-rich repeat 231..253 CDD:275380
leucine-rich repeat 254..276 CDD:275380 5/10 (50%)
leucine-rich repeat 277..299 CDD:275380 4/21 (19%)
leucine-rich repeat 300..322 CDD:275380 6/22 (27%)
leucine-rich repeat 323..345 CDD:275380 13/21 (62%)
leucine-rich repeat 346..368 CDD:275380 8/21 (38%)
leucine-rich repeat 369..392 CDD:275380 7/22 (32%)
leucine-rich repeat 417..440 CDD:275380 0/22 (0%)
leucine-rich repeat 441..486 CDD:275380 16/44 (36%)
PPP1R42 472..617 CDD:455733 38/117 (32%)
leucine-rich repeat 487..507 CDD:275380 4/19 (21%)
leucine-rich repeat 510..532 CDD:275380 5/21 (24%)
leucine-rich repeat 556..578 CDD:275380 8/23 (35%)
leucine-rich repeat 603..626 CDD:275380
PIRL8NP_194335.2 LRR 35..>280 CDD:443914 89/301 (30%)
leucine-rich repeat 84..105 CDD:275380 6/20 (30%)
leucine-rich repeat 106..128 CDD:275380 13/21 (62%)
leucine-rich repeat 129..151 CDD:275380 8/21 (38%)
leucine-rich repeat 152..175 CDD:275380 8/46 (17%)
leucine-rich repeat 176..198 CDD:275380 8/21 (38%)
leucine-rich repeat 199..221 CDD:275380 8/21 (38%)
leucine-rich repeat 222..246 CDD:275380 9/44 (20%)
leucine-rich repeat 247..269 CDD:275380 10/21 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.