DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sur-8 and PIRL8

DIOPT Version :9

Sequence 1:NP_001262665.1 Gene:Sur-8 / 42093 FlyBaseID:FBgn0038504 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_194335.2 Gene:PIRL8 / 828711 AraportID:AT4G26050 Length:383 Species:Arabidopsis thaliana


Alignment Length:325 Identity:96/325 - (29%)
Similarity:150/325 - (46%) Gaps:75/325 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 TAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPED-IGNCVNLSALDL 328
            ||...|.||  |:..|.|....:..|.::...|.:::.||:|:|:::.:||. :...:||.||||
plant    49 TAKEGDRRQ--NIKTLDLSGMSLASLSASSINLASISKLDLSNNNIQKIPESLVARMLNLWALDL 111

  Fly   329 QHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGL 393
            |.|:|..:|:|||.|..|..|.:..|.|.|:|.|:::|:|::|.|...|.:|:|||.:     |.
plant   112 QSNQLKTLPNSIGCLSKLKFLNVSGNYLQSLPKTIEDCRSLEELNANFNELTRLPDAI-----GF 171

  Fly   394 TTITLSRNQFASYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDI 458
                               :.||                        ||||::..|.|..||..:
plant   172 -------------------ELTN------------------------LTKLSVNSNKLVLLPNSV 193

  Fly   459 GTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVL 523
            ....::..|:...|.|..||:|:.||.||::|.:|.|.                     ..:..|
plant   194 SYLTSLRVLDARLNRLSSLPEDLENLVNLQVLNVSQNF---------------------QHLTTL 237

  Fly   524 PHEIGLLHELQRLILQTNQITMLPRSIGHLGNLTHLSVSENNLQFLPEEI--GSLESLENLYINQ 586
            |:.:|||..|..|.:..|.||:||.|:|.|..:..|||..|.|...|.|:  ..||:|:. |:::
plant   238 PYSVGLLISLVELDVSYNGITVLPDSLGCLRRIQKLSVEGNPLISPPFEVVEQGLEALKQ-YMSE 301

  Fly   587  586
            plant   302  301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sur-8NP_001262665.1 leucine-rich repeat 163..184 CDD:275380
leucine-rich repeat 185..207 CDD:275380
LRR_RI 204..401 CDD:238064 47/136 (35%)
LRR_8 207..264 CDD:290566
leucine-rich repeat 208..230 CDD:275380
leucine-rich repeat 231..253 CDD:275380
LRR_8 252..310 CDD:290566 14/44 (32%)
leucine-rich repeat 254..276 CDD:275380 5/10 (50%)
leucine-rich repeat 277..299 CDD:275380 4/21 (19%)
LRR_8 299..356 CDD:290566 23/57 (40%)
leucine-rich repeat 300..322 CDD:275380 6/22 (27%)
leucine-rich repeat 323..345 CDD:275380 13/21 (62%)
LRR_8 344..403 CDD:290566 17/58 (29%)
leucine-rich repeat 346..368 CDD:275380 8/21 (38%)
leucine-rich repeat 369..392 CDD:275380 7/22 (32%)
LRR_RI <379..566 CDD:238064 47/186 (25%)
leucine-rich repeat 417..440 CDD:275380 0/22 (0%)
leucine-rich repeat 441..486 CDD:275380 16/44 (36%)
LRR_8 463..520 CDD:290566 13/56 (23%)
leucine-rich repeat 487..507 CDD:275380 4/19 (21%)
leucine-rich repeat 510..532 CDD:275380 5/21 (24%)
LRR_8 532..588 CDD:290566 21/57 (37%)
leucine-rich repeat 556..578 CDD:275380 8/23 (35%)
leucine-rich repeat 603..626 CDD:275380
PIRL8NP_194335.2 PRK15370 <81..>308 CDD:185268 86/291 (30%)
leucine-rich repeat 84..105 CDD:275380 6/20 (30%)
leucine-rich repeat 106..128 CDD:275380 13/21 (62%)
leucine-rich repeat 129..151 CDD:275380 8/21 (38%)
leucine-rich repeat 152..175 CDD:275380 8/46 (17%)
leucine-rich repeat 176..198 CDD:275380 8/21 (38%)
leucine-rich repeat 199..221 CDD:275380 8/21 (38%)
leucine-rich repeat 222..246 CDD:275380 9/44 (20%)
leucine-rich repeat 247..269 CDD:275380 10/21 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3538
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.