DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sur-8 and SNC1

DIOPT Version :9

Sequence 1:NP_001262665.1 Gene:Sur-8 / 42093 FlyBaseID:FBgn0038504 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_001319970.1 Gene:SNC1 / 827397 AraportID:AT4G16890 Length:1437 Species:Arabidopsis thaliana


Alignment Length:653 Identity:155/653 - (23%)
Similarity:245/653 - (37%) Gaps:226/653 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 SKPIQADQDVIKALQRCR--DEG---------------IKRLDLSKSSITVIPSTVKECVHLTEL 188
            ::|:..|::..|.::..:  :.|               ::.||.....:..:|||.| ..:|..|
plant   541 TRPLLIDKESFKGMRNLQYLEIGYYGDLPQSLVYLPLKLRLLDWDDCPLKSLPSTFK-AEYLVNL 604

  Fly   189 YL------------------------YSNKIGQLPPEIGCLVSLRNLAL-NENSLTSLPESLQNC 228
            .:                        |||.:.:: |::...::|..|.| ...||.:||.|:||.
plant   605 IMKYSKLEKLWEGTLPLGSLKEMNLRYSNNLKEI-PDLSLAINLEELDLVGCKSLVTLPSSIQNA 668

  Fly   229 SQLKVLDLRHNKLAEIPPVIYRLRSLTTLYL-------RFNRITAVADDL------RQLV----- 275
            ::|..||:...|..|..|....|.||..|.|       .|..|.....|:      .::|     
plant   669 TKLIYLDMSDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSDVDFPEGRNEIVVEDCF 733

  Fly   276 --------------------------NLTMLSLRENKIRELGSAIGALVNLTTLDVSHN-HLEHL 313
                                      .|..|::|..|..:|...|.:|.:|..:|:|.: :|..:
plant   734 WNKNLPAGLDYLDCLTRCMPCEFRPEQLAFLNVRGYKHEKLWEGIQSLGSLEGMDLSESENLTEI 798

  Fly   314 PEDIGNCVNLSALDLQH-NELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGN 377
            | |:.....|.:|.|.: ..|:.:|.:||||..||||.|            |.|          .
plant   799 P-DLSKATKLESLILNNCKSLVTLPSTIGNLHRLVRLEM------------KEC----------T 840

  Fly   378 GITQLPDGMLASLSGLTTITLSR-NQFASYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGL 441
            |:..||..:  :||.|.|:.||. :...|:|...    ||:..:.||:..|::||..| .....|
plant   841 GLEVLPTDV--NLSSLETLDLSGCSSLRSFPLIS----TNIVWLYLENTAIEEIPSTI-GNLHRL 898

  Fly   442 TKLNMKE-NMLTALPLDIG-------------------------TWVNMVELNLATNALQKLPD- 479
            .:|.||: ..|..||.|:.                         .|     |.|...|::::|| 
plant   899 VRLEMKKCTGLEVLPTDVNLSSLETLDLSGCSSLRSFPLISESIKW-----LYLENTAIEEIPDL 958

  Fly   480 -DIMNLQNLEILILSNN--MLKKIPNTIGNLRKLRILDLEE-NRIEVLPHEIGLLH--------- 531
             ...||:||::    ||  .|..:|.|||||:||...:::| ..:||||.::.|..         
plant   959 SKATNLKNLKL----NNCKSLVTLPTTIGNLQKLVSFEMKECTGLEVLPIDVNLSSLMILDLSGC 1019

  Fly   532 -----------ELQRLILQTNQITMLPRSIGHLGNLTHLSVSE-NNLQFLPEEIGSLESL----- 579
                       .:..|.|:...|..:|.:||:|..|..|.:.| ..|:.||.:: :|.||     
plant  1020 SSLRTFPLISTNIVWLYLENTAIEEIPSTIGNLHRLVKLEMKECTGLEVLPTDV-NLSSLMILDL 1083

  Fly   580 ----------------ENLYINQNPGLEKLP-----------FELALCQNLKYLNIDKCPLSTIP 617
                            |.||: ||..:|::|           ..:..||.||          ||.
plant  1084 SGCSSLRTFPLISTRIECLYL-QNTAIEEVPCCIEDFTRLTVLMMYCCQRLK----------TIS 1137

  Fly   618 PEI 620
            |.|
plant  1138 PNI 1140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sur-8NP_001262665.1 leucine-rich repeat 163..184 CDD:275380 6/20 (30%)
leucine-rich repeat 185..207 CDD:275380 6/45 (13%)
LRR_RI 204..401 CDD:238064 63/244 (26%)
LRR_8 207..264 CDD:290566 22/64 (34%)
leucine-rich repeat 208..230 CDD:275380 10/22 (45%)
leucine-rich repeat 231..253 CDD:275380 7/21 (33%)
LRR_8 252..310 CDD:290566 18/102 (18%)
leucine-rich repeat 254..276 CDD:275380 7/65 (11%)
leucine-rich repeat 277..299 CDD:275380 7/21 (33%)
LRR_8 299..356 CDD:290566 20/58 (34%)
leucine-rich repeat 300..322 CDD:275380 6/22 (27%)
leucine-rich repeat 323..345 CDD:275380 9/22 (41%)
LRR_8 344..403 CDD:290566 16/59 (27%)
leucine-rich repeat 346..368 CDD:275380 7/21 (33%)
leucine-rich repeat 369..392 CDD:275380 4/22 (18%)
LRR_RI <379..566 CDD:238064 63/239 (26%)
leucine-rich repeat 417..440 CDD:275380 6/22 (27%)
leucine-rich repeat 441..486 CDD:275380 16/72 (22%)
LRR_8 463..520 CDD:290566 21/61 (34%)
leucine-rich repeat 487..507 CDD:275380 8/21 (38%)
leucine-rich repeat 510..532 CDD:275380 7/42 (17%)
LRR_8 532..588 CDD:290566 20/77 (26%)
leucine-rich repeat 556..578 CDD:275380 7/22 (32%)
leucine-rich repeat 603..626 CDD:275380 6/18 (33%)
SNC1NP_001319970.1 LRR_3 13..1346 CDD:332712 155/653 (24%)
leucine-rich repeat 579..594 CDD:275380 2/14 (14%)
leucine-rich repeat 601..623 CDD:275380 2/21 (10%)
LRR <619..869 CDD:227223 68/275 (25%)
leucine-rich repeat 624..646 CDD:275380 4/22 (18%)
leucine-rich repeat 647..670 CDD:275380 10/22 (45%)
leucine-rich repeat 671..693 CDD:275380 7/21 (33%)
leucine-rich repeat 705..763 CDD:275380 5/57 (9%)
leucine-rich repeat 784..806 CDD:275380 6/22 (27%)
leucine-rich repeat 807..830 CDD:275380 9/22 (41%)
leucine-rich repeat 831..853 CDD:275380 11/45 (24%)
leucine-rich repeat 854..874 CDD:275380 6/23 (26%)
leucine-rich repeat 875..897 CDD:275380 6/22 (27%)
leucine-rich repeat 898..920 CDD:275380 8/21 (38%)
leucine-rich repeat 921..941 CDD:275380 0/19 (0%)
leucine-rich repeat 942..963 CDD:275380 6/25 (24%)
leucine-rich repeat 964..987 CDD:275380 12/26 (46%)
leucine-rich repeat 988..1021 CDD:275380 7/32 (22%)
leucine-rich repeat 1022..1054 CDD:275380 7/31 (23%)
leucine-rich repeat 1055..1077 CDD:275380 7/22 (32%)
leucine-rich repeat 1099..1124 CDD:275380 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.