DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sur-8 and RLP36

DIOPT Version :9

Sequence 1:NP_001262665.1 Gene:Sur-8 / 42093 FlyBaseID:FBgn0038504 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_188941.1 Gene:RLP36 / 821875 AraportID:AT3G23010 Length:595 Species:Arabidopsis thaliana


Alignment Length:457 Identity:121/457 - (26%)
Similarity:191/457 - (41%) Gaps:72/457 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 SITVIPSTVK------------------ECVHLTELYL-YSNKIGQLPPEIGCLVSLRNLALNEN 216
            |:.:|||.|.                  ....|..||: ::|..|.:|..|..||:|..|.::.|
plant    86 SLLMIPSLVHIDLSQNHFEGPIDFRNTFSLSRLRVLYVGFNNLDGLIPESISKLVNLEYLDVSHN 150

  Fly   217 SL-TSLPESLQNCSQLKVLDLRHNKL-AEIPPVIYRLRSLTTLYLRFNRITAVADDLRQL--VNL 277
            :. ..:|.|:.....|..:||.:||| .::|..::|...|..:.|.:|.....|..:..:  .:|
plant   151 NFGGQVPRSISKVVNLTSVDLSYNKLEGQVPDFVWRSSKLDYVDLSYNSFNCFAKSVEVIDGASL 215

  Fly   278 TMLSLRENKI-RELGSAIGALVNLTTLDVSHNHLE-HLPEDIGNCVNLSALDLQHNEL------L 334
            |||:|..|.: ......|..:.:|..||:|:||.. .:|:.:........|:|::|.|      |
plant   216 TMLNLGSNSVDGPFPKWICKVKDLYALDLSNNHFNGSIPQCLKYSTYFHTLNLRNNSLSGVLPNL 280

  Fly   335 DIPDSIGNLKSLVRLGMRYNRL-SSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITL 398
            .|.||  .|:|   |.:..|.| ..:|.:|.||:.::..||:||.|.......|.||..|..:.|
plant   281 FIKDS--QLRS---LDVSSNNLVGKLPKSLINCERIEFLNVKGNKIMDTFPFWLGSLPYLKVLML 340

  Fly   399 SRNQFASYPTGGPAQFTNVYSINL----EHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIG 459
            ..|.|.. |...|:.:....||.:    .:|.:..:|...|:        |..|..|.....||.
plant   341 GSNAFYG-PVYNPSAYLGFPSIRIIDISNNNFVGSLPQDYFA--------NWLEMSLVWSGSDIP 396

  Fly   460 TWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNL-RKLRILDLEENRIE-V 522
            .:..|..:|.:|.       |.::|           :.|.:......: .....:|...||.. .
plant   397 QFKYMGNVNFSTY-------DSIDL-----------VYKGVETDFDRIFEGFNAIDFSGNRFSGH 443

  Fly   523 LPHEIGLLHELQRLILQTNQIT-MLPRSIGHLGNLTHLSVSENNLQ-FLPEEIGSLESLENLYIN 585
            :|..||||.||:.|.|..|..| .:|.|:.::.||..|.:|.|||. .:|..:|.|..|.|...:
plant   444 IPGSIGLLSELRLLNLSGNAFTGNIPPSLANITNLESLDLSRNNLSGEIPISLGKLSFLSNTNFS 508

  Fly   586 QN 587
            .|
plant   509 YN 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sur-8NP_001262665.1 leucine-rich repeat 163..184 CDD:275380 5/30 (17%)
leucine-rich repeat 185..207 CDD:275380 8/22 (36%)
LRR_RI 204..401 CDD:238064 60/209 (29%)
LRR_8 207..264 CDD:290566 16/58 (28%)
leucine-rich repeat 208..230 CDD:275380 5/22 (23%)
leucine-rich repeat 231..253 CDD:275380 8/22 (36%)
LRR_8 252..310 CDD:290566 16/60 (27%)
leucine-rich repeat 254..276 CDD:275380 4/23 (17%)
leucine-rich repeat 277..299 CDD:275380 7/22 (32%)
LRR_8 299..356 CDD:290566 19/63 (30%)
leucine-rich repeat 300..322 CDD:275380 7/22 (32%)
leucine-rich repeat 323..345 CDD:275380 9/27 (33%)
LRR_8 344..403 CDD:290566 19/59 (32%)
leucine-rich repeat 346..368 CDD:275380 7/22 (32%)
leucine-rich repeat 369..392 CDD:275380 8/22 (36%)
LRR_RI <379..566 CDD:238064 47/193 (24%)
leucine-rich repeat 417..440 CDD:275380 5/26 (19%)
leucine-rich repeat 441..486 CDD:275380 10/44 (23%)
LRR_8 463..520 CDD:290566 8/57 (14%)
leucine-rich repeat 487..507 CDD:275380 1/19 (5%)
leucine-rich repeat 510..532 CDD:275380 8/22 (36%)
LRR_8 532..588 CDD:290566 21/58 (36%)
leucine-rich repeat 556..578 CDD:275380 9/22 (41%)
leucine-rich repeat 603..626 CDD:275380
RLP36NP_188941.1 LRR_RI <16..201 CDD:238064 30/114 (26%)
leucine-rich repeat 22..44 CDD:275380
leucine-rich repeat 45..68 CDD:275380
leucine-rich repeat 69..92 CDD:275380 2/5 (40%)
leucine-rich repeat 93..117 CDD:275380 1/23 (4%)
LRR_8 116..176 CDD:290566 18/59 (31%)
leucine-rich repeat 118..141 CDD:275380 8/22 (36%)
leucine-rich repeat 142..165 CDD:275380 5/22 (23%)
leucine-rich repeat 166..189 CDD:275380 8/22 (36%)
leucine-rich repeat 239..262 CDD:275380 7/22 (32%)
leucine-rich repeat 263..286 CDD:275380 8/24 (33%)
LRR_8 264..321 CDD:290566 21/61 (34%)
leucine-rich repeat 287..310 CDD:275380 9/25 (36%)
leucine-rich repeat 311..334 CDD:275380 8/22 (36%)
leucine-rich repeat 361..403 CDD:275380 10/49 (20%)
leucine-rich repeat 404..477 CDD:275380 21/90 (23%)
leucine-rich repeat 478..499 CDD:275380 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54393
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.