DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sur-8 and PIRL9

DIOPT Version :9

Sequence 1:NP_001262665.1 Gene:Sur-8 / 42093 FlyBaseID:FBgn0038504 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_187741.2 Gene:PIRL9 / 820306 AraportID:AT3G11330 Length:499 Species:Arabidopsis thaliana


Alignment Length:270 Identity:84/270 - (31%)
Similarity:138/270 - (51%) Gaps:3/270 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 ETRPKMVTVKHPESNKPKPTTKKSKPIQADQDVIKALQRCRDEGIKRLDLSKSSITVIPSTVKEC 182
            |...::|.:............:....::.:::|:..||......:.|:|||...:.::|......
plant   156 EAEERLVRIYESAEKNAAEDEENVAAVEVNEEVVGILQHASANPVDRVDLSGRKLRLLPEAFGRI 220

  Fly   183 VHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPV 247
            ..|..|.|.:||:..:|..|..|.||..|.::.|||.:||:|:...|:||:|::..|||..:|..
plant   221 QGLLVLNLSNNKLESIPDSIAGLHSLVELDVSTNSLETLPDSIGLLSKLKILNVSTNKLTSLPDS 285

  Fly   248 IYRLRSLTTLYLRFNRITAVADDL-RQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLE 311
            |.|..||..|.:.|||:|.:..:: .:||||..|.::.||||...::||.:.:|..||...|.|.
plant   286 ICRCGSLVILDVSFNRLTYLPTNIGPELVNLEKLLVQYNKIRSFPTSIGEMRSLKHLDAHFNELN 350

  Fly   312 HLPEDIGNCVNLSALDLQHN--ELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNV 374
            .||:......||..|:|..|  :|.|:|.|.|.|.||..|.:..|::.::|.|.....|:.:.||
plant   351 GLPDSFVLLTNLEYLNLSSNFSDLKDLPFSFGELISLQELDLSNNQIHALPDTFGTLDSLTKLNV 415

  Fly   375 EGNGITQLPD 384
            :.|.:...|:
plant   416 DQNPLVVPPE 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sur-8NP_001262665.1 leucine-rich repeat 163..184 CDD:275380 5/20 (25%)
leucine-rich repeat 185..207 CDD:275380 8/21 (38%)
LRR_RI 204..401 CDD:238064 67/184 (36%)
LRR_8 207..264 CDD:290566 24/56 (43%)
leucine-rich repeat 208..230 CDD:275380 8/21 (38%)
leucine-rich repeat 231..253 CDD:275380 9/21 (43%)
LRR_8 252..310 CDD:290566 22/58 (38%)
leucine-rich repeat 254..276 CDD:275380 7/22 (32%)
leucine-rich repeat 277..299 CDD:275380 8/21 (38%)
LRR_8 299..356 CDD:290566 22/58 (38%)
leucine-rich repeat 300..322 CDD:275380 7/21 (33%)
leucine-rich repeat 323..345 CDD:275380 10/23 (43%)
LRR_8 344..403 CDD:290566 11/41 (27%)
leucine-rich repeat 346..368 CDD:275380 5/21 (24%)
leucine-rich repeat 369..392 CDD:275380 4/16 (25%)
LRR_RI <379..566 CDD:238064 1/6 (17%)
leucine-rich repeat 417..440 CDD:275380
leucine-rich repeat 441..486 CDD:275380
LRR_8 463..520 CDD:290566
leucine-rich repeat 487..507 CDD:275380
leucine-rich repeat 510..532 CDD:275380
LRR_8 532..588 CDD:290566
leucine-rich repeat 556..578 CDD:275380
leucine-rich repeat 603..626 CDD:275380
PIRL9NP_187741.2 leucine-rich repeat 202..222 CDD:275380 5/19 (26%)
LRR_RI 205..397 CDD:238064 70/191 (37%)
LRR_8 222..279 CDD:290566 22/56 (39%)
leucine-rich repeat 223..245 CDD:275380 8/21 (38%)
leucine-rich repeat 246..268 CDD:275380 8/21 (38%)
leucine-rich repeat 269..291 CDD:275380 9/21 (43%)
leucine-rich repeat 292..315 CDD:275380 7/22 (32%)
LRR_8 315..370 CDD:290566 20/54 (37%)
leucine-rich repeat 316..338 CDD:275380 8/21 (38%)
leucine-rich repeat 339..361 CDD:275380 7/21 (33%)
LRR_8 360..420 CDD:290566 21/59 (36%)
leucine-rich repeat 362..386 CDD:275380 10/23 (43%)
leucine-rich repeat 387..409 CDD:275380 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3538
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.