DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sur-8 and Lrrc57

DIOPT Version :9

Sequence 1:NP_001262665.1 Gene:Sur-8 / 42093 FlyBaseID:FBgn0038504 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_001153082.1 Gene:Lrrc57 / 66606 MGIID:1913856 Length:281 Species:Mus musculus


Alignment Length:266 Identity:73/266 - (27%)
Similarity:122/266 - (45%) Gaps:74/266 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 SSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSIN 421
            |::.|.::..:....|.::..|:|:.|    :.|..||                    :|:.:|:
Mouse    46 SALRAHVETAQKTGVFQLKDRGLTEFP----SELQKLT--------------------SNLRTID 86

  Fly   422 LEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDDIMNLQN 486
            |.:|:||.:|                       ||.||.:..:..|:|..|.|..|||::.||:.
Mouse    87 LSNNKIDSLP-----------------------PLIIGKFTLLKSLSLNNNKLTVLPDELCNLKK 128

  Fly   487 LEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRSIG 551
            ||.|.|:||.|:::|:|.|.|..|:.|.|..|::..||.::..|..|..:.|..|||    ||| 
Mouse   129 LETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCCLRHLDVVDLSKNQI----RSI- 188

  Fly   552 HLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALCQNLKYLNIDK-C-PLS 614
                              |:.:|.|:::| |.:|||. :.:|..:::.|..||.|.::: | .||
Mouse   189 ------------------PDTVGELQAIE-LNLNQNQ-ISQLSVKISCCPRLKVLRLEENCLELS 233

  Fly   615 TIPPEI 620
            .:|..|
Mouse   234 MLPQSI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sur-8NP_001262665.1 leucine-rich repeat 163..184 CDD:275380
leucine-rich repeat 185..207 CDD:275380
LRR_RI 204..401 CDD:238064 9/43 (21%)
LRR_8 207..264 CDD:290566
leucine-rich repeat 208..230 CDD:275380
leucine-rich repeat 231..253 CDD:275380
LRR_8 252..310 CDD:290566
leucine-rich repeat 254..276 CDD:275380
leucine-rich repeat 277..299 CDD:275380
LRR_8 299..356 CDD:290566
leucine-rich repeat 300..322 CDD:275380
leucine-rich repeat 323..345 CDD:275380
LRR_8 344..403 CDD:290566 9/45 (20%)
leucine-rich repeat 346..368 CDD:275380 2/10 (20%)
leucine-rich repeat 369..392 CDD:275380 5/22 (23%)
LRR_RI <379..566 CDD:238064 51/186 (27%)
leucine-rich repeat 417..440 CDD:275380 6/22 (27%)
leucine-rich repeat 441..486 CDD:275380 13/44 (30%)
LRR_8 463..520 CDD:290566 24/56 (43%)
leucine-rich repeat 487..507 CDD:275380 10/19 (53%)
leucine-rich repeat 510..532 CDD:275380 7/21 (33%)
LRR_8 532..588 CDD:290566 15/55 (27%)
leucine-rich repeat 556..578 CDD:275380 3/21 (14%)
leucine-rich repeat 603..626 CDD:275380 8/20 (40%)
Lrrc57NP_001153082.1 LRR <62..>211 CDD:227223 60/220 (27%)
leucine-rich repeat 82..105 CDD:275380 10/45 (22%)
leucine-rich repeat 106..128 CDD:275380 9/21 (43%)
leucine-rich repeat 129..151 CDD:275380 11/21 (52%)
leucine-rich repeat 152..174 CDD:275380 7/21 (33%)
leucine-rich repeat 175..197 CDD:275380 11/44 (25%)
leucine-rich repeat 198..219 CDD:275380 7/22 (32%)
leucine-rich repeat 220..241 CDD:275380 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.