DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sur-8 and si:dkey-1h4.4

DIOPT Version :9

Sequence 1:NP_001262665.1 Gene:Sur-8 / 42093 FlyBaseID:FBgn0038504 Length:694 Species:Drosophila melanogaster
Sequence 2:XP_021333533.1 Gene:si:dkey-1h4.4 / 566734 ZFINID:ZDB-GENE-160728-41 Length:251 Species:Danio rerio


Alignment Length:251 Identity:71/251 - (28%)
Similarity:118/251 - (47%) Gaps:23/251 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 CRDEGIKRLDLSKSSITVIPSTVKECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSL 221
            |.::..:.|::|...:.|:|..|...|.|.:|:|.:|::...|.||..|..|..|.|:.|.||.|
Zfish    10 CFNKQQESLNMSHRGLVVLPPGVSRLVTLKKLFLNNNQLILPPDEILHLEKLEELILDRNQLTML 74

  Fly   222 PESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENK 286
            |.::.:...|..|.:.||.|:.:|..:..|..|..|:               .|...::|     
Zfish    75 PSNIGSLKHLTYLGINHNPLSVLPEALGDLTELRELW---------------AVGCGLIS----- 119

  Fly   287 IRELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGM 351
               |.|:||.|..|..|.|.:|.:.:||...|:..||..|:|..|:|.|:|:.|.:|.|||.:.:
Zfish   120 ---LPSSIGKLSKLQKLGVHNNIITNLPSQFGSLSNLQWLNLADNKLQDLPEDINHLPSLVFINL 181

  Fly   352 RYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYP 407
            ..|..:.:|..|.:..::...:::.|.|..|.|.::...|.||.:.:..|.....|
Zfish   182 DKNCFTDIPTVLTDMANLQILSLKFNSIRTLEDYLIPGFSRLTKLDIRENPLMDRP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sur-8NP_001262665.1 leucine-rich repeat 163..184 CDD:275380 5/20 (25%)
leucine-rich repeat 185..207 CDD:275380 8/21 (38%)
LRR_RI 204..401 CDD:238064 55/196 (28%)
LRR_8 207..264 CDD:290566 17/56 (30%)
leucine-rich repeat 208..230 CDD:275380 8/21 (38%)
leucine-rich repeat 231..253 CDD:275380 7/21 (33%)
LRR_8 252..310 CDD:290566 13/57 (23%)
leucine-rich repeat 254..276 CDD:275380 2/21 (10%)
leucine-rich repeat 277..299 CDD:275380 6/21 (29%)
LRR_8 299..356 CDD:290566 21/56 (38%)
leucine-rich repeat 300..322 CDD:275380 7/21 (33%)
leucine-rich repeat 323..345 CDD:275380 9/21 (43%)
LRR_8 344..403 CDD:290566 14/58 (24%)
leucine-rich repeat 346..368 CDD:275380 5/21 (24%)
leucine-rich repeat 369..392 CDD:275380 4/22 (18%)
LRR_RI <379..566 CDD:238064 8/29 (28%)
leucine-rich repeat 417..440 CDD:275380
leucine-rich repeat 441..486 CDD:275380
LRR_8 463..520 CDD:290566
leucine-rich repeat 487..507 CDD:275380
leucine-rich repeat 510..532 CDD:275380
LRR_8 532..588 CDD:290566
leucine-rich repeat 556..578 CDD:275380
leucine-rich repeat 603..626 CDD:275380
si:dkey-1h4.4XP_021333533.1 leucine-rich repeat 16..34 CDD:275380 5/17 (29%)
LRR <32..>238 CDD:227223 66/229 (29%)
leucine-rich repeat 38..60 CDD:275380 8/21 (38%)
leucine-rich repeat 61..83 CDD:275380 8/21 (38%)
leucine-rich repeat 84..106 CDD:275380 7/21 (33%)
leucine-rich repeat 107..129 CDD:275380 9/44 (20%)
leucine-rich repeat 130..152 CDD:275380 7/21 (33%)
leucine-rich repeat 153..175 CDD:275380 9/21 (43%)
leucine-rich repeat 176..198 CDD:275380 5/21 (24%)
leucine-rich repeat 199..222 CDD:275380 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.