DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sur-8 and LRCH4

DIOPT Version :10

Sequence 1:NP_001262665.1 Gene:Sur-8 / 42093 FlyBaseID:FBgn0038504 Length:694 Species:Drosophila melanogaster
Sequence 2:XP_047276334.1 Gene:LRCH4 / 4034 HGNCID:6691 Length:727 Species:Homo sapiens


Alignment Length:272 Identity:74/272 - (27%)
Similarity:117/272 - (43%) Gaps:60/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 RELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSAL---DLQHNELLDIPDSIGNLKSLVRL 349
            |....|:...|...||::|:..|:|.|.......:||.:   ||..|...::|::...|.||..|
Human    32 RSAERALEEAVATGTLNLSNRRLKHFPRGAARSYDLSDITQADLSRNRFPEVPEAACQLVSLEGL 96

  Fly   350 GMRYNRLSSV-PATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQ 413
            .:.:|.|..: ||                         |.:|:.||.:.|||||.:..|.     
Human    97 SLYHNCLRCLNPA-------------------------LGNLTALTYLNLSRNQLSLLPP----- 131

  Fly   414 FTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLP 478
                        .|.::|         |..|.:..|.|.|||.||||..::.:|::::|.||.||
Human   132 ------------YICQLP---------LRVLIVSNNKLGALPPDIGTLGSLRQLDVSSNELQSLP 175

  Fly   479 DDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQI 543
            .::..|.:|..|.:..|.|..:|..:|:|..:| ||...||:..:|.....|..||.::|.:|.:
Human   176 SELCGLSSLRDLNVRRNQLSTLPEELGDLPLVR-LDFSCNRVSRIPVSFCRLRHLQVILLDSNPL 239

  Fly   544 ----TMLPRSIG 551
                ...|.|:|
Human   240 QSPPAQRPGSVG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sur-8NP_001262665.1 leucine-rich repeat 163..184 CDD:275380
LRR 185..535 CDD:443914 68/250 (27%)
leucine-rich repeat 185..207 CDD:275380
leucine-rich repeat 208..230 CDD:275380
leucine-rich repeat 231..253 CDD:275380
leucine-rich repeat 254..276 CDD:275380
leucine-rich repeat 277..299 CDD:275380 2/10 (20%)
leucine-rich repeat 300..322 CDD:275380 6/21 (29%)
leucine-rich repeat 323..345 CDD:275380 7/24 (29%)
leucine-rich repeat 346..368 CDD:275380 6/22 (27%)
leucine-rich repeat 369..392 CDD:275380 2/22 (9%)
leucine-rich repeat 417..440 CDD:275380 2/22 (9%)
leucine-rich repeat 441..486 CDD:275380 18/44 (41%)
PPP1R42 472..617 CDD:455733 27/84 (32%)
leucine-rich repeat 487..507 CDD:275380 6/19 (32%)
leucine-rich repeat 510..532 CDD:275380 7/21 (33%)
leucine-rich repeat 556..578 CDD:275380
leucine-rich repeat 603..626 CDD:275380
LRCH4XP_047276334.1 leucine-rich repeat 46..69 CDD:275380 7/22 (32%)
LRR <65..>241 CDD:443914 62/227 (27%)
leucine-rich repeat 70..92 CDD:275380 5/21 (24%)
leucine-rich repeat 93..115 CDD:275380 8/46 (17%)
leucine-rich repeat 116..131 CDD:275380 7/14 (50%)
leucine-rich repeat 138..160 CDD:275380 11/21 (52%)
leucine-rich repeat 161..183 CDD:275380 7/21 (33%)
leucine-rich repeat 184..204 CDD:275380 6/19 (32%)
leucine-rich repeat 206..228 CDD:275380 7/22 (32%)
CH_SF 540..>623 CDD:469584
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.