DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sur-8 and CG10307

DIOPT Version :10

Sequence 1:NP_001262665.1 Gene:Sur-8 / 42093 FlyBaseID:FBgn0038504 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_611605.1 Gene:CG10307 / 37477 FlyBaseID:FBgn0034655 Length:341 Species:Drosophila melanogaster


Alignment Length:333 Identity:85/333 - (25%)
Similarity:141/333 - (42%) Gaps:91/333 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 LQNC-----SQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRE 284
            |.||     .:...|:|.|.:::::|.:|.:..:|..|:|..|::|.:...:..|:.|.:|:|..
  Fly    14 LANCEDAIYKKAFSLNLSHYQISDVPGIIEKCETLMKLFLNQNKLTKIPSSIGSLMRLQVLTLDY 78

  Fly   285 NKIRELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRL 349
            ||:.|....|..||.|..|::|.|::..||.::|....|......:..||::|:.|         
  Fly    79 NKLDEFPLCICRLVRLKFLNISCNNISSLPPELGYLTQLETFWCNNTGLLELPNEI--------- 134

  Fly   350 GMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPD--GMLASLSGLTTITLSRNQFASYPTGGPA 412
                          :||:.::...|.||.:.:|||  |.|:||..||                  
  Fly   135 --------------RNCEHLETLGVRGNPLKKLPDAIGALSSLRWLT------------------ 167

  Fly   413 QFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKL 477
                                     |:|..        |:.:||.:....|:|.|||..|.|::|
  Fly   168 -------------------------AEGCE--------LSEVPLTMALLGNLVHLNLKGNRLRRL 199

  Fly   478 PDDIMNLQNLEILILSNNMLKKIP--NTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLIL-Q 539
            |..:|.:|.|....|:.|.:.::|  :.:..||.|.:|:|.:|       .|.|..:||.:.| |
  Fly   200 PRMLMAMQKLRFAFLNENCIDEMPTRSQLEELRTLHMLNLSKN-------PISLHRDLQLMALRQ 257

  Fly   540 TNQITMLP 547
            ||....||
  Fly   258 TNLYVELP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sur-8NP_001262665.1 leucine-rich repeat 163..184 CDD:275380
LRR 185..535 CDD:443914 78/318 (25%)
leucine-rich repeat 185..207 CDD:275380
leucine-rich repeat 208..230 CDD:275380 3/9 (33%)
leucine-rich repeat 231..253 CDD:275380 5/21 (24%)
leucine-rich repeat 254..276 CDD:275380 6/21 (29%)
leucine-rich repeat 277..299 CDD:275380 8/21 (38%)
leucine-rich repeat 300..322 CDD:275380 7/21 (33%)
leucine-rich repeat 323..345 CDD:275380 5/21 (24%)
leucine-rich repeat 346..368 CDD:275380 2/21 (10%)
leucine-rich repeat 369..392 CDD:275380 10/24 (42%)
leucine-rich repeat 417..440 CDD:275380 1/22 (5%)
leucine-rich repeat 441..486 CDD:275380 13/44 (30%)
PPP1R42 472..617 CDD:455733 26/79 (33%)
leucine-rich repeat 487..507 CDD:275380 4/21 (19%)
leucine-rich repeat 510..532 CDD:275380 6/21 (29%)
leucine-rich repeat 556..578 CDD:275380
leucine-rich repeat 603..626 CDD:275380
CG10307NP_611605.1 leucine-rich repeat 27..44 CDD:275380 5/16 (31%)
LRR <39..>276 CDD:443914 79/308 (26%)
leucine-rich repeat 48..70 CDD:275380 6/21 (29%)
leucine-rich repeat 71..93 CDD:275380 8/21 (38%)
leucine-rich repeat 94..116 CDD:275380 7/21 (33%)
leucine-rich repeat 117..139 CDD:275380 7/44 (16%)
leucine-rich repeat 140..162 CDD:275380 8/21 (38%)
leucine-rich repeat 163..185 CDD:275380 8/72 (11%)
leucine-rich repeat 186..208 CDD:275380 9/21 (43%)
leucine-rich repeat 209..233 CDD:275380 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.