DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sur-8 and SCRIB

DIOPT Version :9

Sequence 1:NP_001262665.1 Gene:Sur-8 / 42093 FlyBaseID:FBgn0038504 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_874365.3 Gene:SCRIB / 23513 HGNCID:30377 Length:1655 Species:Homo sapiens


Alignment Length:517 Identity:146/517 - (28%)
Similarity:226/517 - (43%) Gaps:103/517 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 KHPESNKPKPTTKKSKPIQADQDVIKALQRCRDEGIKRLDLSKSSITVIPSTVKECVHLTELYLY 191
            :|.||     ..|:...:||..:.|....|..:|    |.|..:.:..:|......::|.:|.|.
Human    12 RHVES-----VDKRHCSLQAVPEEIYRYSRSLEE----LLLDANQLRELPKPFFRLLNLRKLGLS 67

  Fly   192 SNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTT 256
            .|:|.:||||:...:.|..|.::.|.:..:|||::.|..|::.|...|.|:.:|....:||||..
Human    68 DNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRLPDGFTQLRSLAH 132

  Fly   257 LYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCV 321
            |.|....:.|:..|:..|.||..|.||||.::.|.:::..||.|..||:..|.||.||:.:|...
Human   133 LALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLDLGGNDLEVLPDTLGALP 197

  Fly   322 NLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGM 386
            ||..|.|..|:|..:|..:|||:.||.|.:..|||..:|                          
Human   198 NLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLEELP-------------------------- 236

  Fly   387 LASLSGLTTITLSRNQFASYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENML 451
             |.|.||..                                             ||.|.:.:|:|
Human   237 -AELGGLVL---------------------------------------------LTDLLLSQNLL 255

  Fly   452 TALPLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLE 516
            ..||..||....:..|.:..|.|.::.:.|.:.:||..|||:.|:|..:|.::|.|.||..|:::
Human   256 RRLPDGIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENLLMALPRSLGKLTKLTNLNVD 320

  Fly   517 ENRIEVLPHEIGLLHELQRLILQTNQITMLPRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLEN 581
            .|.:|.||.|||....|..|.|:.|::.:||..:.|...|..|.|:.|.||.||..:..| :|:.
Human   321 RNHLEALPPEIGGCVALSVLSLRDNRLAVLPPELAHTTELHVLDVAGNRLQSLPFALTHL-NLKA 384

  Fly   582 LYINQNPGLEKLPFE----------LALCQNLKYLNIDKCPLSTIPPEIQAGGP--SLVLQW 631
            |::.:|.....|.|:          :..|    || :.:.|    ||.::..|.  ||...|
Human   385 LWLAENQAQPMLRFQTEDDARTGEKVLTC----YL-LPQQP----PPSLEDAGQQGSLSETW 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sur-8NP_001262665.1 leucine-rich repeat 163..184 CDD:275380 3/20 (15%)
leucine-rich repeat 185..207 CDD:275380 9/21 (43%)
LRR_RI 204..401 CDD:238064 61/196 (31%)
LRR_8 207..264 CDD:290566 18/56 (32%)
leucine-rich repeat 208..230 CDD:275380 7/21 (33%)
leucine-rich repeat 231..253 CDD:275380 6/21 (29%)
LRR_8 252..310 CDD:290566 22/57 (39%)
leucine-rich repeat 254..276 CDD:275380 6/21 (29%)
leucine-rich repeat 277..299 CDD:275380 8/21 (38%)
LRR_8 299..356 CDD:290566 23/56 (41%)
leucine-rich repeat 300..322 CDD:275380 9/21 (43%)
leucine-rich repeat 323..345 CDD:275380 9/21 (43%)
LRR_8 344..403 CDD:290566 11/58 (19%)
leucine-rich repeat 346..368 CDD:275380 7/21 (33%)
leucine-rich repeat 369..392 CDD:275380 2/22 (9%)
LRR_RI <379..566 CDD:238064 48/186 (26%)
leucine-rich repeat 417..440 CDD:275380 0/22 (0%)
leucine-rich repeat 441..486 CDD:275380 13/44 (30%)
LRR_8 463..520 CDD:290566 18/56 (32%)
leucine-rich repeat 487..507 CDD:275380 8/19 (42%)
leucine-rich repeat 510..532 CDD:275380 9/21 (43%)
LRR_8 532..588 CDD:290566 18/55 (33%)
leucine-rich repeat 556..578 CDD:275380 9/21 (43%)
leucine-rich repeat 603..626 CDD:275380 6/24 (25%)
SCRIBNP_874365.3 Sufficient for targeting to adherens junction and to inhibit cell proliferation 1..818 146/517 (28%)
LRR_RI 12..232 CDD:238064 75/228 (33%)
leucine-rich repeat 14..37 CDD:275380 6/27 (22%)
leucine-rich repeat 38..60 CDD:275380 4/25 (16%)
LRR 39..401 CDD:227223 128/438 (29%)
leucine-rich repeat 61..83 CDD:275380 9/21 (43%)
leucine-rich repeat 84..106 CDD:275380 7/21 (33%)
leucine-rich repeat 107..129 CDD:275380 6/21 (29%)
leucine-rich repeat 130..152 CDD:275380 6/21 (29%)
leucine-rich repeat 153..175 CDD:275380 8/21 (38%)
leucine-rich repeat 176..198 CDD:275380 9/21 (43%)
leucine-rich repeat 199..221 CDD:275380 9/21 (43%)
leucine-rich repeat 268..290 CDD:275380 4/21 (19%)
leucine-rich repeat 291..313 CDD:275380 9/21 (43%)
leucine-rich repeat 314..336 CDD:275380 9/21 (43%)
leucine-rich repeat 360..381 CDD:275380 9/21 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 417..440 7/25 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 459..604
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 633..702
Interaction with ARHGEF7. /evidence=ECO:0000269|PubMed:15182672 717..1229
PDZ 725..813 CDD:214570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 827..853
PDZ_signaling 860..947 CDD:238492
PDZ_signaling 1002..1090 CDD:238492
PDZ_signaling 1098..1189 CDD:238492
Interaction with tick-borne encephalitis virus RNA-directed RNA polymerase NS5. /evidence=ECO:0000269|PubMed:18042258 1105..1117
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1227..1246
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1277..1489
AbLIM_anchor 1555..>1593 CDD:292800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.