DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment sds22 and LRRC46

DIOPT Version :9

Sequence 1:	NP_650619.1	Gene:	sds22 / 42091	FlyBaseID:	FBgn0028992	Length:	326	Species:	Drosophila melanogaster
Sequence 2:	XP_005257832.1	Gene:	LRRC46 / 90506	HGNCID:	25047	Length:	330	Species:	Homo sapiens

Alignment Length:	130	Identity:	44/130 - (33%)
Similarity:	64/130 - (49%)	Gaps:	9/130 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   191 TLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANL 255
            ||..|:.:.|....|..|.|||.|.||..||:..|.::.||||:....|..|.||.|:::.:.||
Human    51 TLDELQTVRLDREGITTIRNLEGLQNLHSLYLQGNKIQQIENLACIPSLRFLSLAGNQIRQVENL 115

  Fly   256 EKLELLEELWLNHNGVDDWKDIELLKVN---KALQTIYLEYNPLAKDVRYRSKLRDILPQLQKID 317
            ..|..|:.|.|:.|      .||.||::   ::|..:.|..|.......||..:.:.||.|..:|
Human   116 LDLPCLQFLDLSEN------LIETLKLDEFPQSLLILNLSGNSCTNQDGYRELVTEALPLLLDLD 174

Fly 318 317
Human 175 174

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
sds22	NP_650619.1	leucine-rich repeat	43..62	CDD:275380
		LRR_8	61..117	CDD:290566
		leucine-rich repeat	63..84	CDD:275380
		LRR_4	83..125	CDD:289563
		leucine-rich repeat	85..106	CDD:275380
		LRR_8	105..183	CDD:290566
		leucine-rich repeat	107..128	CDD:275380
		LRR_4	128..168	CDD:289563
		leucine-rich repeat	129..150	CDD:275380
		LRR_4	149..189	CDD:289563
		leucine-rich repeat	151..172	CDD:275380
		leucine-rich repeat	173..194	CDD:275380	2/2 (100%)
		LRR_8	194..249	CDD:290566	22/54 (41%)
		LRR_4	194..235	CDD:289563	17/40 (43%)
		leucine-rich repeat	195..216	CDD:275380	8/20 (40%)
		leucine-rich repeat	217..238	CDD:275380	8/20 (40%)
LRRC46	XP_005257832.1	LRR_8	54..109	CDD:290566	22/54 (41%)
		leucine-rich repeat	55..76	CDD:275378	8/20 (40%)
		LRR_4	75..115	CDD:289563	14/39 (36%)
		leucine-rich repeat	77..98	CDD:275378	8/20 (40%)
		LRR_8	97..151	CDD:290566	18/59 (31%)
		LRR_4	97..135	CDD:289563	14/43 (33%)
		leucine-rich repeat	99..120	CDD:275378	8/20 (40%)
		leucine-rich repeat	121..142	CDD:275378	8/26 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0531
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810