DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and AT1G13910

DIOPT Version :9

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_172844.1 Gene:AT1G13910 / 837950 AraportID:AT1G13910 Length:330 Species:Arabidopsis thaliana


Alignment Length:304 Identity:74/304 - (24%)
Similarity:124/304 - (40%) Gaps:80/304 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 NFEPLTRIERLFLRWNLIKK-------------------IENLSSLKTLIELELYD--------N 93
            :.:.|..|::| :.|.|:..                   ...:...:.:::||:|.        .
plant    32 DMKALNEIKKL-VGWRLVYSWVGDDPCGDGVLPPWSGVTCSKVGDYRVVVKLEVYSMSIVGNFPK 95

  Fly    94 QITKIENLDDLPHLEVLDISFNRLT-----KIENLDKLVKLEKVYFVSNRITQI--ENLDMLTNL 151
            .|||:  ||    |.|||:..|:||     :|..|.:|:.|...:   |::.|.  ..:..|.:|
plant    96 AITKL--LD----LTVLDMHNNKLTGPIPPEIGRLKRLITLNLRW---NKLQQALPPEIGGLKSL 151

  Fly   152 TMLELGDNKLKKIENIEMLVNLRQL---------FLGK-----NKIAKIENLDTLVNLEILSLQA 202
            |.|.|..|..|. |..:.|.||.:|         |.|:     ..:.|:.:||...|        
plant   152 TYLYLSFNNFKG-EIPKELANLHELQYLHIQENHFTGRIPAELGTLQKLRHLDAGNN-------- 207

  Fly   203 NRIVKIENLEKLAN----LRELYVSEN----GVETIENLSENTKLETLDLAKNRLKGI--ANLEK 257
            |.:..|.:|.::..    ||.|:::.|    |:.  ..|:..|.||.|.|:.|::.|.  |.|..
plant   208 NLVGSISDLFRIEGCFPALRNLFLNNNYLTGGLP--NKLANLTNLEILYLSFNKMTGAIPAALAS 270

  Fly   258 LELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDVR 301
            :..|..|.|:|| :.:....|....:..|:.:|:|.|....||:
plant   271 IPRLTNLHLDHN-LFNGSIPEAFYKHPNLKDMYIEGNAFKSDVK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380 1/5 (20%)
LRR_8 61..117 CDD:290566 17/82 (21%)
leucine-rich repeat 63..84 CDD:275380 4/39 (10%)
LRR_4 83..125 CDD:289563 17/54 (31%)
leucine-rich repeat 85..106 CDD:275380 8/28 (29%)
LRR_8 105..183 CDD:290566 27/98 (28%)
leucine-rich repeat 107..128 CDD:275380 10/25 (40%)
LRR_4 128..168 CDD:289563 11/41 (27%)
leucine-rich repeat 129..150 CDD:275380 4/22 (18%)
LRR_4 149..189 CDD:289563 14/53 (26%)
leucine-rich repeat 151..172 CDD:275380 8/20 (40%)
leucine-rich repeat 173..194 CDD:275380 7/34 (21%)
LRR_8 194..249 CDD:290566 16/62 (26%)
LRR_4 194..235 CDD:289563 10/48 (21%)
leucine-rich repeat 195..216 CDD:275380 3/20 (15%)
leucine-rich repeat 217..238 CDD:275380 6/24 (25%)
AT1G13910NP_172844.1 PLN00113 89..>298 CDD:215061 60/229 (26%)
leucine-rich repeat 103..126 CDD:275380 9/22 (41%)
leucine-rich repeat 127..150 CDD:275380 5/25 (20%)
leucine-rich repeat 151..174 CDD:275380 10/23 (43%)
leucine-rich repeat 175..198 CDD:275380 3/22 (14%)
leucine-rich repeat 199..225 CDD:275380 6/33 (18%)
leucine-rich repeat 226..249 CDD:275380 6/24 (25%)
leucine-rich repeat 250..273 CDD:275380 8/22 (36%)
leucine-rich repeat 274..297 CDD:275380 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D968788at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.