DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and AT5G61240

DIOPT Version :9

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001190586.1 Gene:AT5G61240 / 836245 AraportID:AT5G61240 Length:339 Species:Arabidopsis thaliana


Alignment Length:235 Identity:70/235 - (29%)
Similarity:105/235 - (44%) Gaps:64/235 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 KTLIELELYDNQIT-----KIENLDDLPHLEVLDISFNRLT-----KIENLDKL-VKLEKVYFVS 136
            :.:.|||:|...|.     .:.||.||..   ||:..|:||     :|..|.:| |..:.:.|  
plant    73 RVVTELEVYAVSIVGPFPIAVTNLLDLTR---LDLHNNKLTGPIPPQIGRLKRLKVLYDPILF-- 132

  Fly   137 NRITQIENLDMLTNLTMLELGD------NKLKKIENIEMLVN---------------LRQLFLGK 180
             |:    || .||||...:|.|      .:||::.::.:..|               ||.|:|.:
plant   133 -RV----NL-ALTNLRWNKLQDVIPPEIGELKRLTHLYLSFNSFKGEIPKELAALPELRYLYLQE 191

  Fly   181 NK-IAKI-ENLDTLVNLEILSLQANRIV-KIENLEKLAN----LRELYVSEN----GVETIENLS 234
            |: |.:| ..|.||.||..|.:..|.:| .|..|.:...    ||.||::.|    |:..  .||
plant   192 NRLIGRIPAELGTLQNLRHLDVGNNHLVGTIRELIRFDGSFPALRNLYLNNNYLSGGIPA--QLS 254

  Fly   235 ENTKLETLDLAKNRLKG-----IANLEKLELLEELWLNHN 269
            ..|.||.:.|:.|:..|     ||::.||..   |:|:||
plant   255 NLTNLEIVYLSYNKFIGNIPFAIAHIPKLTY---LYLDHN 291

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380
LRR_8 61..117 CDD:290566 12/38 (32%)