Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011522320.1 | Gene: | DRC3 / 83450 | HGNCID: | 25384 | Length: | 562 | Species: | Homo sapiens |
Alignment Length: | 222 | Identity: | 71/222 - (31%) |
---|---|---|---|
Similarity: | 113/222 - (50%) | Gaps: | 35/222 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 IKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSN 137
Fly 138 RITQIENLDMLTNLTMLELGDNKLKKIENIEMLVN---LRQLFLGKNKIAKIEN--------LDT 191
Fly 192 LVNLEI---------LSLQANRIVKIEN---LEKLANLRELYVSENGVETIENLSENTKLETLDL 244
Fly 245 AKNRLKGIANLEKLELLEELWLNH-NG 270 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | |
LRR_8 | 61..117 | CDD:290566 | 21/43 (49%) | ||
leucine-rich repeat | 63..84 | CDD:275380 | 4/10 (40%) | ||
LRR_4 | 83..125 | CDD:289563 | 20/41 (49%) | ||
leucine-rich repeat | 85..106 | CDD:275380 | 10/20 (50%) | ||
LRR_8 | 105..183 | CDD:290566 | 35/80 (44%) | ||
leucine-rich repeat | 107..128 | CDD:275380 | 11/20 (55%) | ||
LRR_4 | 128..168 | CDD:289563 | 15/39 (38%) | ||
leucine-rich repeat | 129..150 | CDD:275380 | 9/20 (45%) | ||
LRR_4 | 149..189 | CDD:289563 | 15/50 (30%) | ||
leucine-rich repeat | 151..172 | CDD:275380 | 8/20 (40%) | ||
leucine-rich repeat | 173..194 | CDD:275380 | 9/28 (32%) | ||
LRR_8 | 194..249 | CDD:290566 | 11/66 (17%) | ||
LRR_4 | 194..235 | CDD:289563 | 9/52 (17%) | ||
leucine-rich repeat | 195..216 | CDD:275380 | 5/32 (16%) | ||
leucine-rich repeat | 217..238 | CDD:275380 | 3/20 (15%) | ||
DRC3 | XP_011522320.1 | leucine-rich repeat | 87..108 | CDD:275378 | 10/20 (50%) |
LRR_9 | 88..213 | CDD:317038 | 49/124 (40%) | ||
leucine-rich repeat | 109..130 | CDD:275378 | 11/20 (55%) | ||
leucine-rich repeat | 131..152 | CDD:275378 | 9/20 (45%) | ||
leucine-rich repeat | 153..177 | CDD:275378 | 8/23 (35%) | ||
leucine-rich repeat | 178..189 | CDD:275378 | 5/10 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |