DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and DRC3

DIOPT Version :9

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_011522320.1 Gene:DRC3 / 83450 HGNCID:25384 Length:562 Species:Homo sapiens


Alignment Length:222 Identity:71/222 - (31%)
Similarity:113/222 - (50%) Gaps:35/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSN 137
            |.:|:||...:.|.:|:|.:|.|.|||.|::|.||..||:|||.:..||.||.||.||.:...:|
Human    75 ILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNN 139

  Fly   138 RITQIENLDMLTNLTMLELGDNKLKKIENIEMLVN---LRQLFLGKNKIAKIEN--------LDT 191
            ||::|::||.|..|.:|.||:|::..:.||..|..   ||.|.|.:|.|::.|:        |..
Human   140 RISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKMFICAYLPD 204

  Fly   192 LVNLEI---------LSLQANRIVKIEN---LEKLANLRELYVSENGVETIENLSENTKLETLDL 244
            |:.|:.         :||..::..:.::   .:|||..:..|       :|:.|.....|....|
Human   205 LMYLDYRRIDDHTASVSLSVSQPCETDSSSPQKKLAEAKHQY-------SIDELKHQENLMQAQL 262

  Fly   245 AKNRLKGIANLEKLELLEELWLNH-NG 270
            ...:    |..|:||..:..::.| ||
Human   263 EDEQ----AQREELEKHKTAFVEHLNG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380
LRR_8 61..117 CDD:290566 21/43 (49%)
leucine-rich repeat 63..84 CDD:275380 4/10 (40%)
LRR_4 83..125 CDD:289563 20/41 (49%)
leucine-rich repeat 85..106 CDD:275380 10/20 (50%)
LRR_8 105..183 CDD:290566 35/80 (44%)
leucine-rich repeat 107..128 CDD:275380 11/20 (55%)
LRR_4 128..168 CDD:289563 15/39 (38%)
leucine-rich repeat 129..150 CDD:275380 9/20 (45%)
LRR_4 149..189 CDD:289563 15/50 (30%)
leucine-rich repeat 151..172 CDD:275380 8/20 (40%)
leucine-rich repeat 173..194 CDD:275380 9/28 (32%)
LRR_8 194..249 CDD:290566 11/66 (17%)
LRR_4 194..235 CDD:289563 9/52 (17%)
leucine-rich repeat 195..216 CDD:275380 5/32 (16%)
leucine-rich repeat 217..238 CDD:275380 3/20 (15%)
DRC3XP_011522320.1 leucine-rich repeat 87..108 CDD:275378 10/20 (50%)
LRR_9 88..213 CDD:317038 49/124 (40%)
leucine-rich repeat 109..130 CDD:275378 11/20 (55%)
leucine-rich repeat 131..152 CDD:275378 9/20 (45%)
leucine-rich repeat 153..177 CDD:275378 8/23 (35%)
leucine-rich repeat 178..189 CDD:275378 5/10 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.