DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and AT5G22320

DIOPT Version :10

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_568416.1 Gene:AT5G22320 / 832292 AraportID:AT5G22320 Length:452 Species:Arabidopsis thaliana


Alignment Length:249 Identity:81/249 - (32%)
Similarity:132/249 - (53%) Gaps:7/249 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNR 138
            ||..:..|:|   ||.|....:|.:..|....:||.||:.||.||.::.|...|.|:.:..|.|:
plant    13 KKTNDPDSVK---ELNLGHKALTDVSCLSKFKNLEKLDLRFNNLTDLQGLKSCVNLKWLSVVENK 74

  Fly   139 ITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQAN 203
            :..:..::.||.||:|..|.||||.:..|..|||||.|.|..|:|:.|..||.|.:|..|.|..|
plant    75 LQSLNGIEALTKLTVLNAGKNKLKSMNEISSLVNLRALILNDNEISSICKLDLLKDLNSLVLSRN 139

  Fly   204 RIVKI-ENLEKLANLRELYVSENGVETI-ENLSENTKLETLDLAKNRLKGI-ANLEKLELLEELW 265
            .|.:| ::|.||.||.::.:|:..::.| .:|...:.|:.|.||.|.:|.: |.|...:.|..|.
plant   140 PISEIGDSLSKLKNLSKISLSDCRIKAIGSSLKSCSDLKELRLANNEIKALPAELAVNKRLLNLD 204

  Fly   266 LNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKLRD-ILPQLQKIDA 318
            :.:|.:.....:|:|.....|:.:.:..||::.:.:...|:|. :||.:...:|
plant   205 VGNNVITQLSGLEVLGTLSCLRNLNIRGNPISDNDKSAKKVRTLLLPSVNVFNA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380
PPP1R42 44..208 CDD:455733 51/133 (38%)
leucine-rich repeat 63..84 CDD:275380 3/9 (33%)
leucine-rich repeat 85..106 CDD:275380 5/20 (25%)
leucine-rich repeat 107..128 CDD:275380 9/20 (45%)
leucine-rich repeat 129..150 CDD:275380 4/20 (20%)
PPP1R42 132..317 CDD:455733 60/188 (32%)
leucine-rich repeat 151..172 CDD:275380 10/20 (50%)
leucine-rich repeat 173..194 CDD:275380 10/20 (50%)
leucine-rich repeat 195..216 CDD:275380 9/21 (43%)
leucine-rich repeat 217..238 CDD:275380 4/21 (19%)
AT5G22320NP_568416.1 LRR 2..>243 CDD:443914 76/232 (33%)
leucine-rich repeat 21..42 CDD:275380 6/23 (26%)
leucine-rich repeat 43..64 CDD:275380 9/20 (45%)
leucine-rich repeat 65..86 CDD:275380 4/20 (20%)
leucine-rich repeat 87..108 CDD:275380 10/20 (50%)
leucine-rich repeat 109..130 CDD:275380 10/20 (50%)
leucine-rich repeat 131..153 CDD:275380 9/21 (43%)
leucine-rich repeat 154..176 CDD:275380 4/21 (19%)
leucine-rich repeat 177..199 CDD:275380 8/21 (38%)
leucine-rich repeat 200..224 CDD:275380 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.