| Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001184160.1 | Gene: | lrrcc1 / 780229 | XenbaseID: | XB-GENE-992687 | Length: | 1032 | Species: | Xenopus tropicalis |
| Alignment Length: | 211 | Identity: | 66/211 - (31%) |
|---|---|---|---|
| Similarity: | 102/211 - (48%) | Gaps: | 38/211 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 74 KKIENLSSL---KTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFV 135
Fly 136 SNRITQIENLDMLTNLTMLELGDNKLKKIENIEML----VNLRQLFLGKNKIAKIEN-LDTLVNL 195
Fly 196 EI---LSLQAN------------RIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLA 245
Fly 246 KNRLKGIANLEKLELL 261 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | |
| LRR_8 | 61..117 | CDD:290566 | 18/45 (40%) | ||
| leucine-rich repeat | 63..84 | CDD:275380 | 4/12 (33%) | ||
| LRR_4 | 83..125 | CDD:289563 | 19/41 (46%) | ||
| leucine-rich repeat | 85..106 | CDD:275380 | 9/20 (45%) | ||
| LRR_8 | 105..183 | CDD:290566 | 28/81 (35%) | ||
| leucine-rich repeat | 107..128 | CDD:275380 | 12/20 (60%) | ||
| LRR_4 | 128..168 | CDD:289563 | 11/39 (28%) | ||
| leucine-rich repeat | 129..150 | CDD:275380 | 6/20 (30%) | ||
| LRR_4 | 149..189 | CDD:289563 | 13/44 (30%) | ||
| leucine-rich repeat | 151..172 | CDD:275380 | 5/24 (21%) | ||
| leucine-rich repeat | 173..194 | CDD:275380 | 8/21 (38%) | ||
| LRR_8 | 194..249 | CDD:290566 | 14/69 (20%) | ||
| LRR_4 | 194..235 | CDD:289563 | 12/55 (22%) | ||
| leucine-rich repeat | 195..216 | CDD:275380 | 9/35 (26%) | ||
| leucine-rich repeat | 217..238 | CDD:275380 | 3/20 (15%) | ||
| lrrcc1 | NP_001184160.1 | leucine-rich repeat | 9..29 | CDD:275380 | 4/12 (33%) |
| LRR_8 | 28..84 | CDD:290566 | 23/55 (42%) | ||
| leucine-rich repeat | 30..51 | CDD:275380 | 9/20 (45%) | ||
| LRR_4 | 52..85 | CDD:289563 | 14/32 (44%) | ||
| leucine-rich repeat | 52..73 | CDD:275380 | 12/20 (60%) | ||
| LRR_4 | 72..112 | CDD:289563 | 11/39 (28%) | ||
| leucine-rich repeat | 74..95 | CDD:275380 | 6/20 (30%) | ||
| LRR_8 | 95..156 | CDD:290566 | 18/60 (30%) | ||
| LRR_4 | 95..138 | CDD:289563 | 13/42 (31%) | ||
| leucine-rich repeat | 96..121 | CDD:275380 | 5/24 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||