Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017951824.1 | Gene: | lrrc9 / 780204 | XenbaseID: | XB-GENE-1011352 | Length: | 1514 | Species: | Xenopus tropicalis |
Alignment Length: | 400 | Identity: | 102/400 - (25%) |
---|---|---|---|
Similarity: | 152/400 - (38%) | Gaps: | 124/400 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 AEDVAS----IEDIITIDP----------------------DCYE----LDLNHRRIEKLENFEP 59
Fly 60 LTRIERLFLRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLT------ 118
Fly 119 --------KIENLD---------------------KLVKLEKVYFV------------SNRITQI 142
Fly 143 ENL--------------------------------------DMLTNLTMLELGDNKLKKIENIEM 169
Fly 170 LVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSEN---GVE--T 229
Fly 230 IENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYN 294
Fly 295 P-LAKDVRYR 303 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | 5/22 (23%) |
LRR_8 | 61..117 | CDD:290566 | 16/55 (29%) | ||
leucine-rich repeat | 63..84 | CDD:275380 | 5/20 (25%) | ||
LRR_4 | 83..125 | CDD:289563 | 15/76 (20%) | ||
leucine-rich repeat | 85..106 | CDD:275380 | 6/20 (30%) | ||
LRR_8 | 105..183 | CDD:290566 | 31/162 (19%) | ||
leucine-rich repeat | 107..128 | CDD:275380 | 10/55 (18%) | ||
LRR_4 | 128..168 | CDD:289563 | 14/89 (16%) | ||
leucine-rich repeat | 129..150 | CDD:275380 | 7/70 (10%) | ||
LRR_4 | 149..189 | CDD:289563 | 17/39 (44%) | ||
leucine-rich repeat | 151..172 | CDD:275380 | 8/20 (40%) | ||
leucine-rich repeat | 173..194 | CDD:275380 | 7/20 (35%) | ||
LRR_8 | 194..249 | CDD:290566 | 24/59 (41%) | ||
LRR_4 | 194..235 | CDD:289563 | 20/45 (44%) | ||
leucine-rich repeat | 195..216 | CDD:275380 | 11/20 (55%) | ||
leucine-rich repeat | 217..238 | CDD:275380 | 9/25 (36%) | ||
lrrc9 | XP_017951824.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |