Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002932323.1 | Gene: | cep97 / 779623 | XenbaseID: | XB-GENE-949463 | Length: | 810 | Species: | Xenopus tropicalis |
Alignment Length: | 237 | Identity: | 65/237 - (27%) |
---|---|---|---|
Similarity: | 113/237 - (47%) | Gaps: | 11/237 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 LDLNHRRIEKLENFEPL-TRIERLFLRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHL 107
Fly 108 EVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVN 172
Fly 173 LRQLFLGKNKIAKIENLDTLV--NLEILSLQANRIVKIEN---LEKLANLRELYVSEN----GVE 228
Fly 229 TIENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNG 270 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | 5/18 (28%) |
LRR_8 | 61..117 | CDD:290566 | 15/55 (27%) | ||
leucine-rich repeat | 63..84 | CDD:275380 | 6/20 (30%) | ||
LRR_4 | 83..125 | CDD:289563 | 11/41 (27%) | ||
leucine-rich repeat | 85..106 | CDD:275380 | 4/20 (20%) | ||
LRR_8 | 105..183 | CDD:290566 | 25/77 (32%) | ||
leucine-rich repeat | 107..128 | CDD:275380 | 7/20 (35%) | ||
LRR_4 | 128..168 | CDD:289563 | 11/39 (28%) | ||
leucine-rich repeat | 129..150 | CDD:275380 | 4/20 (20%) | ||
LRR_4 | 149..189 | CDD:289563 | 14/39 (36%) | ||
leucine-rich repeat | 151..172 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 173..194 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 194..249 | CDD:290566 | 15/61 (25%) | ||
LRR_4 | 194..235 | CDD:289563 | 14/47 (30%) | ||
leucine-rich repeat | 195..216 | CDD:275380 | 9/23 (39%) | ||
leucine-rich repeat | 217..238 | CDD:275380 | 4/24 (17%) | ||
cep97 | XP_002932323.1 | leucine-rich repeat | 15..34 | CDD:275380 | 5/18 (28%) |
leucine-rich repeat | 35..56 | CDD:275380 | 6/20 (30%) | ||
internalin_A | <43..>194 | CDD:380193 | 45/150 (30%) | ||
leucine-rich repeat | 57..78 | CDD:275380 | 4/20 (20%) | ||
leucine-rich repeat | 79..100 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 101..122 | CDD:275380 | 4/20 (20%) | ||
leucine-rich repeat | 123..146 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 147..168 | CDD:275380 | 5/20 (25%) | ||
leucine-rich repeat | 169..193 | CDD:275380 | 9/23 (39%) | ||
IQ | 521..536 | CDD:197470 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |