DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and cep97

DIOPT Version :9

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_002932323.1 Gene:cep97 / 779623 XenbaseID:XB-GENE-949463 Length:810 Species:Xenopus tropicalis


Alignment Length:237 Identity:65/237 - (27%)
Similarity:113/237 - (47%) Gaps:11/237 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LDLNHRRIEKLENFEPL-TRIERLFLRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHL 107
            :||:.:.::||....|. ...:.|.|..|.|.|:|::...:.|::|.:.:|::.::..:..|.||
 Frog    15 VDLSGQGLQKLSPTLPFGNDTQTLILDKNQIIKLEHMEKCRNLVQLSVANNRLVRMMGVAKLIHL 79

  Fly   108 EVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVN 172
            .||::..|.:..:|.|..||.||.:....|.:..|:.::..|:|..|:|.||.:.:|.::..|.:
 Frog    80 RVLNLPHNSIGYVEGLKDLVNLEWLNLAGNNLKIIDQINSCTSLQHLDLSDNNISQIGDLSKLKS 144

  Fly   173 LRQLFLGKNKIAKIENLDTLV--NLEILSLQANRIVKIEN---LEKLANLRELYVSEN----GVE 228
            |:.|.|..|.||.:......:  :|.||||..|.|..:..   |..||:|.:|.:..|    ...
 Frog   145 LKTLLLHGNNIASLRAASACLPQSLTILSLAENEIRDLNEVAFLAGLADLEQLSIMNNPCVMATP 209

  Fly   229 TIENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNG 270
            :|........:.:..|....|.|....:| |.|:..||...|
 Frog   210 SIPGFDYRPFIVSWCLNLKVLDGYVVSQK-ESLKAEWLYSQG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380 5/18 (28%)
LRR_8 61..117 CDD:290566 15/55 (27%)
leucine-rich repeat 63..84 CDD:275380 6/20 (30%)
LRR_4 83..125 CDD:289563 11/41 (27%)
leucine-rich repeat 85..106 CDD:275380 4/20 (20%)
LRR_8 105..183 CDD:290566 25/77 (32%)
leucine-rich repeat 107..128 CDD:275380 7/20 (35%)
LRR_4 128..168 CDD:289563 11/39 (28%)
leucine-rich repeat 129..150 CDD:275380 4/20 (20%)
LRR_4 149..189 CDD:289563 14/39 (36%)
leucine-rich repeat 151..172 CDD:275380 7/20 (35%)
leucine-rich repeat 173..194 CDD:275380 6/22 (27%)
LRR_8 194..249 CDD:290566 15/61 (25%)
LRR_4 194..235 CDD:289563 14/47 (30%)
leucine-rich repeat 195..216 CDD:275380 9/23 (39%)
leucine-rich repeat 217..238 CDD:275380 4/24 (17%)
cep97XP_002932323.1 leucine-rich repeat 15..34 CDD:275380 5/18 (28%)
leucine-rich repeat 35..56 CDD:275380 6/20 (30%)
internalin_A <43..>194 CDD:380193 45/150 (30%)
leucine-rich repeat 57..78 CDD:275380 4/20 (20%)
leucine-rich repeat 79..100 CDD:275380 7/20 (35%)
leucine-rich repeat 101..122 CDD:275380 4/20 (20%)
leucine-rich repeat 123..146 CDD:275380 7/22 (32%)
leucine-rich repeat 147..168 CDD:275380 5/20 (25%)
leucine-rich repeat 169..193 CDD:275380 9/23 (39%)
IQ 521..536 CDD:197470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.