DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and Lrriq1

DIOPT Version :9

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_011241894.1 Gene:Lrriq1 / 74978 MGIID:1922228 Length:1717 Species:Mus musculus


Alignment Length:358 Identity:85/358 - (23%)
Similarity:161/358 - (44%) Gaps:59/358 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TVSGIQVIPAEDVASIEDIITIDP--DCYELDLNHRRIEK-----------LENFEPLTRIERLF 67
            :||.:.|:.:.:...:..:.|..|  :.:|.: .|::|.|           :...:|...::  :
Mouse   741 SVSQLTVLSSVEERRLAWVKTFKPWAEIFEQN-QHKKIVKKRRLVKCPPNTMPPLDPSAILQ--Y 802

  Fly    68 LRWNLIKKIENLS-------SLKTLIE------LELYDNQITKIENLDDLPHLEVLDISFNRLTK 119
            ..|..:|::..::       ||.||.|      |.|....:|.::.|.....|:.:|...|.:..
Mouse   803 GPWKSLKQVPVITFQGLPGCSLSTLAECSNLQILSLRRCGLTSLQGLSHCTRLKYIDAQENHIEA 867

  Fly   120 I--ENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNK 182
            |  |||:   .|..|...:|.:|.|...|..|||..|||..||:.:|..:|.|..|::|.:..|:
Mouse   868 ISCENLE---NLSVVLLNNNLLTSIHGFDGCTNLQSLELSHNKITRISGLESLKYLQELTVDHNQ 929

  Fly   183 IAKIENL-------------------DTLVN---LEILSLQANRIVKIENLEKLANLRELYVSEN 225
            :...:.|                   |.:.|   |:|:.||.|.:.:..:|.....||||::.:|
Mouse   930 LISTKGLCEAPTIVYLDCSHNHLTGIDGIGNCGLLQIIKLQGNYLREPPSLRNHVLLRELHLDDN 994

  Fly   226 GVETIENLSE--NTKLETLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIEL-LKVNKALQ 287
            .:.::|.||.  ...|:.|.:::|.|..|..|..|..||:|.:::|.:.|..::.. .....:|:
Mouse   995 SISSVEGLSSCWLPLLQYLSISQNSLATIVPLFHLVSLEKLDVSNNCLSDLTNVMCWFNACYSLR 1059

  Fly   288 TIYLEYNPLAKDVRYRSKLRDILPQLQKIDATL 320
            .:.|..||:.:::.:|..:...||.|:.::..:
Mouse  1060 ELCLTGNPVLQEINWRDSILKTLPALRVLNGDM 1092

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380 5/29 (17%)
LRR_8 61..117 CDD:290566 14/68 (21%)
leucine-rich repeat 63..84 CDD:275380 4/27 (15%)
LRR_4 83..125 CDD:289563 14/49 (29%)
leucine-rich repeat 85..106 CDD:275380 6/26 (23%)
LRR_8 105..183 CDD:290566 27/79 (34%)
leucine-rich repeat 107..128 CDD:275380 7/22 (32%)
LRR_4 128..168 CDD:289563 15/39 (38%)
leucine-rich repeat 129..150 CDD:275380 6/20 (30%)
LRR_4 149..189 CDD:289563 14/39 (36%)
leucine-rich repeat 151..172 CDD:275380 9/20 (45%)
leucine-rich repeat 173..194 CDD:275380 5/39 (13%)
LRR_8 194..249 CDD:290566 18/59 (31%)
LRR_4 194..235 CDD:289563 14/43 (33%)
leucine-rich repeat 195..216 CDD:275380 6/20 (30%)
leucine-rich repeat 217..238 CDD:275380 8/22 (36%)
Lrriq1XP_011241894.1 PTZ00121 <173..657 CDD:173412
internalin_A 808..>1056 CDD:380193 66/250 (26%)
leucine-rich repeat 833..854 CDD:275380 4/20 (20%)
leucine-rich repeat 855..875 CDD:275380 7/22 (32%)
leucine-rich repeat 876..897 CDD:275380 6/20 (30%)
leucine-rich repeat 898..919 CDD:275380 9/20 (45%)
leucine-rich repeat 920..941 CDD:275380 4/20 (20%)
leucine-rich repeat 942..963 CDD:275380 2/20 (10%)
leucine-rich repeat 964..982 CDD:275380 6/17 (35%)
leucine-rich repeat 986..1009 CDD:275380 8/22 (36%)
leucine-rich repeat 1010..1031 CDD:275380 7/20 (35%)
leucine-rich repeat 1058..1084 CDD:275380 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.