DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and Drc3

DIOPT Version :10

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_083320.1 Gene:Drc3 / 74665 MGIID:1921915 Length:523 Species:Mus musculus


Alignment Length:196 Identity:44/196 - (22%)
Similarity:60/196 - (30%) Gaps:56/196 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KMQA--GLIKSIAHILHDEKFEKIRGPQAMLKLMMLAYYTTKVGVPEVDNHTYGLDMFNDYKQFF 101
            |.||  ||.:|:          |.|.|....||..|...|.        .:|:         .||
Mouse   241 KPQAGTGLKQSL----------KSRSPNMGFKLFALTDCTC--------GYTW---------DFF 278

  Fly   102 FQWAHGCGKKKAVSEFRTVFHLALSNLY----------YQMSPTLIVKDFEKIFQQYFGQLPMIS 156
            ......|..:.....:.||..|...|:.          :..||||.....:|.........|..:
Mouse   279 VYEGKSCASRSEGLSYETVMALVDENMLGSGYKLFVDKFYTSPTLFTDLLDKKVLACGPVWPNRT 343

  Fly   157 GLERKALDKLFGRGMIEKFAWAEN----VMSFGNSREL----------SGRTV--AVRPD-HRIL 204
            |..:...:||..........|...    .:.:.:|||:          .|.||  .||.| ||.|
Mouse   344 GYPKSVKNKLLSNAPRGTMRWIRQDKLLFVEWKDSREVQMCSSFHKAYEGDTVQRKVRQDAHRTL 408

  Fly   205 E 205
            |
Mouse   409 E 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380 4/18 (22%)
PPP1R42 44..208 CDD:455733 40/189 (21%)
leucine-rich repeat 63..84 CDD:275380 5/20 (25%)
leucine-rich repeat 85..106 CDD:275380 3/20 (15%)
leucine-rich repeat 107..128 CDD:275380 4/20 (20%)
leucine-rich repeat 129..150 CDD:275380 5/30 (17%)
PPP1R42 132..317 CDD:455733 23/91 (25%)
leucine-rich repeat 151..172 CDD:275380 4/20 (20%)
leucine-rich repeat 173..194 CDD:275380 5/34 (15%)
leucine-rich repeat 195..216 CDD:275380 8/14 (57%)
leucine-rich repeat 217..238 CDD:275380
Drc3NP_083320.1 LRR 1 44..65
leucine-rich repeat 47..66 CDD:275378
PPP1R42 53..200 CDD:455733
LRR 2 66..87
leucine-rich repeat 67..88 CDD:275378
LRR 3 88..109
leucine-rich repeat 89..110 CDD:275378
LRR 4 110..131
leucine-rich repeat 111..132 CDD:275378
LRR 5 132..153
leucine-rich repeat 133..157 CDD:275378
leucine-rich repeat 158..169 CDD:275378
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.