DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and Lrriq3

DIOPT Version :9

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_083214.2 Gene:Lrriq3 / 74435 MGIID:1921685 Length:633 Species:Mus musculus


Alignment Length:178 Identity:40/178 - (22%)
Similarity:79/178 - (44%) Gaps:22/178 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 LKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIEN---LEKLANLRELYV 222
            ||.:||::..::||......|.:..|:.|.:...|..|.|..|:|..:.:   ...|.||:.||:
Mouse    40 LKSMENLQTCISLRVCIFSNNFLTDIQPLQSCKKLIKLDLHGNQIKTLPDKNFWSGLKNLKLLYL 104

  Fly   223 SENGVETIENLS------ENTKLETLDLAKNRLKGIANLEKLELLEELW----LNHNGVDDWKDI 277
            .:||...::|:.      ....|...|...:..||..::    |:..:|    |:|:.:.|.:.|
Mouse   105 HDNGFSKLKNICVLSGCVSLIGLTMFDCPVSLKKGYRHV----LVNSIWPLKALDHHVISDEEII 165

  Fly   278 ELLKVNKALQT-----IYLEYNPLAKDVRYRSKLRDILPQLQKIDATL 320
            :..::.:..:|     .:..|..|.|...|..::::|...:.:|:..|
Mouse   166 QNWRLPERFKTFSPSLFFNLYPALIKGTTYEDEIKNIKHIISRINEIL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380
LRR_8 61..117 CDD:290566
leucine-rich repeat 63..84 CDD:275380
LRR_4 83..125 CDD:289563
leucine-rich repeat 85..106 CDD:275380
LRR_8 105..183 CDD:290566 7/21 (33%)
leucine-rich repeat 107..128 CDD:275380
LRR_4 128..168 CDD:289563 4/6 (67%)
leucine-rich repeat 129..150 CDD:275380
LRR_4 149..189 CDD:289563 8/27 (30%)
leucine-rich repeat 151..172 CDD:275380 4/10 (40%)
leucine-rich repeat 173..194 CDD:275380 5/20 (25%)
LRR_8 194..249 CDD:290566 15/63 (24%)
LRR_4 194..235 CDD:289563 13/49 (27%)
leucine-rich repeat 195..216 CDD:275380 6/23 (26%)
leucine-rich repeat 217..238 CDD:275380 6/26 (23%)
Lrriq3NP_083214.2 LRR_8 51..109 CDD:338972 16/57 (28%)
LRR 1 51..72 5/20 (25%)
leucine-rich repeat 52..73 CDD:275378 5/20 (25%)
LRR 2 73..94 5/20 (25%)
leucine-rich repeat 74..98 CDD:275378 6/23 (26%)
LRR 3 98..119 7/20 (35%)
leucine-rich repeat 99..112 CDD:275378 5/12 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..343
SidE <459..630 CDD:289056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.