Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157051.1 | Gene: | Lrrcc1 / 71710 | MGIID: | 1918960 | Length: | 1026 | Species: | Mus musculus |
Alignment Length: | 213 | Identity: | 63/213 - (29%) |
---|---|---|---|
Similarity: | 97/213 - (45%) | Gaps: | 32/213 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 118 TKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNK 182
Fly 183 IAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSE----NTKLETLD 243
Fly 244 LAKNRLKGIANLEK----LELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRS 304
Fly 305 KLRDILPQLQKIDATLCK 322 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | |
LRR_8 | 61..117 | CDD:290566 | |||
leucine-rich repeat | 63..84 | CDD:275380 | |||
LRR_4 | 83..125 | CDD:289563 | 2/6 (33%) | ||
leucine-rich repeat | 85..106 | CDD:275380 | |||
LRR_8 | 105..183 | CDD:290566 | 18/64 (28%) | ||
leucine-rich repeat | 107..128 | CDD:275380 | 3/9 (33%) | ||
LRR_4 | 128..168 | CDD:289563 | 8/39 (21%) | ||
leucine-rich repeat | 129..150 | CDD:275380 | 4/20 (20%) | ||
LRR_4 | 149..189 | CDD:289563 | 14/39 (36%) | ||
leucine-rich repeat | 151..172 | CDD:275380 | 5/20 (25%) | ||
leucine-rich repeat | 173..194 | CDD:275380 | 11/20 (55%) | ||
LRR_8 | 194..249 | CDD:290566 | 20/58 (34%) | ||
LRR_4 | 194..235 | CDD:289563 | 15/40 (38%) | ||
leucine-rich repeat | 195..216 | CDD:275380 | 9/20 (45%) | ||
leucine-rich repeat | 217..238 | CDD:275380 | 5/24 (21%) | ||
Lrrcc1 | NP_001157051.1 | LRR | <30..115 | CDD:227223 | 32/84 (38%) |
LRR 1 | 39..60 | 5/20 (25%) | |||
leucine-rich repeat | 43..61 | CDD:275378 | 5/17 (29%) | ||
LRR_4 | 61..101 | CDD:289563 | 18/39 (46%) | ||
LRR 2 | 61..82 | 11/20 (55%) | |||
leucine-rich repeat | 62..83 | CDD:275378 | 11/20 (55%) | ||
LRR_8 | 82..142 | CDD:290566 | 20/59 (34%) | ||
LRR_4 | 82..122 | CDD:289563 | 14/39 (36%) | ||
LRR 3 | 83..104 | 8/20 (40%) | |||
leucine-rich repeat | 84..105 | CDD:275378 | 9/20 (45%) | ||
LRR_4 | 105..148 | CDD:289563 | 12/42 (29%) | ||
LRR 4 | 105..126 | 6/20 (30%) | |||
leucine-rich repeat | 106..131 | CDD:275378 | 5/24 (21%) | ||
LRR 5 | 131..152 | 7/20 (35%) | |||
leucine-rich repeat | 132..145 | CDD:275378 | 4/12 (33%) | ||
leucine-rich repeat | 158..188 | CDD:275380 | 10/50 (20%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 310..338 | ||||
SbcC | <421..952 | CDD:223496 | |||
FAM184 | 793..1026 | CDD:292293 | |||
DUF342 | <817..894 | CDD:302792 | |||
RRF | <915..969 | CDD:294170 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |