| Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006536303.1 | Gene: | Lrrc56 / 70552 | MGIID: | 1917802 | Length: | 559 | Species: | Mus musculus |
| Alignment Length: | 196 | Identity: | 54/196 - (27%) |
|---|---|---|---|
| Similarity: | 93/196 - (47%) | Gaps: | 30/196 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 139 ITQIENLDMLTNLTMLELGDNKLKKIENIEM-LVNLRQLFLGKNKIAKIENLDT-LVNLEILSLQ 201
Fly 202 ANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLEKLELLEEL-W 265
Fly 266 LNHNGVDDWKDIELLK-----VNKALQTIYLEYNPLAKDVRYRSKLRDILPQLQKIDATLCKVPG 325
Fly 326 T 326 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | |
| LRR_8 | 61..117 | CDD:290566 | |||
| leucine-rich repeat | 63..84 | CDD:275380 | |||
| LRR_4 | 83..125 | CDD:289563 | |||
| leucine-rich repeat | 85..106 | CDD:275380 | |||
| LRR_8 | 105..183 | CDD:290566 | 12/44 (27%) | ||
| leucine-rich repeat | 107..128 | CDD:275380 | |||
| LRR_4 | 128..168 | CDD:289563 | 6/28 (21%) | ||
| leucine-rich repeat | 129..150 | CDD:275380 | 2/10 (20%) | ||
| LRR_4 | 149..189 | CDD:289563 | 10/40 (25%) | ||
| leucine-rich repeat | 151..172 | CDD:275380 | 5/21 (24%) | ||
| leucine-rich repeat | 173..194 | CDD:275380 | 7/21 (33%) | ||
| LRR_8 | 194..249 | CDD:290566 | 17/54 (31%) | ||
| LRR_4 | 194..235 | CDD:289563 | 11/40 (28%) | ||
| leucine-rich repeat | 195..216 | CDD:275380 | 3/20 (15%) | ||
| leucine-rich repeat | 217..238 | CDD:275380 | 8/20 (40%) | ||
| Lrrc56 | XP_006536303.1 | internalin_A | <99..>202 | CDD:380193 | 31/107 (29%) |
| leucine-rich repeat | 102..124 | CDD:275380 | 7/21 (33%) | ||
| leucine-rich repeat | 125..146 | CDD:275380 | 3/20 (15%) | ||
| leucine-rich repeat | 147..168 | CDD:275380 | 8/20 (40%) | ||
| leucine-rich repeat | 169..193 | CDD:275380 | 8/23 (35%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||