DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and Lrrc46

DIOPT Version :9

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_081302.2 Gene:Lrrc46 / 69297 MGIID:1916547 Length:323 Species:Mus musculus


Alignment Length:151 Identity:50/151 - (33%)
Similarity:80/151 - (52%) Gaps:5/151 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 EMLVNLRQL-FLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIE 231
            |.|:..|.| |.|...::: :...||..||.:.|....|..|.|||||.|:..||:..|.::.||
Mouse    23 EALITKRNLTFPGDEDLSE-KMFHTLGELETVRLDGEGITCIGNLEKLRNIHSLYLQSNKIQRIE 86

  Fly   232 NLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPL 296
            ||:..|.|..|.||:|:::.:.||..|:.|:.|.|:.|.::   .::|.::.::|..:.|..||.
Mouse    87 NLACITSLRFLSLARNQIRHVENLLDLQYLQFLDLSENLIE---TLKLDELPESLLILNLCGNPC 148

  Fly   297 AKDVRYRSKLRDILPQLQKID 317
            .....||..:...||.|..:|
Mouse   149 TNQEGYRKMVIGALPLLLDLD 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380
LRR_8 61..117 CDD:290566
leucine-rich repeat 63..84 CDD:275380
LRR_4 83..125 CDD:289563
leucine-rich repeat 85..106 CDD:275380
LRR_8 105..183 CDD:290566 6/15 (40%)
leucine-rich repeat 107..128 CDD:275380
LRR_4 128..168 CDD:289563 50/151 (33%)
leucine-rich repeat 129..150 CDD:275380
LRR_4 149..189 CDD:289563 6/21 (29%)
leucine-rich repeat 151..172 CDD:275380 2/3 (67%)
leucine-rich repeat 173..194 CDD:275380 6/21 (29%)
LRR_8 194..249 CDD:290566 24/54 (44%)
LRR_4 194..235 CDD:289563 18/40 (45%)
leucine-rich repeat 195..216 CDD:275380 10/20 (50%)
leucine-rich repeat 217..238 CDD:275380 7/20 (35%)
Lrrc46NP_081302.2 LRR 1 49..70 9/20 (45%)
LRR_4 50..89 CDD:289563 17/38 (45%)
leucine-rich repeat 50..71 CDD:275378 10/20 (50%)
LRR_8 70..126 CDD:290566 21/55 (38%)
LRR_4 71..110 CDD:289563 14/38 (37%)
LRR 2 71..92 8/20 (40%)
leucine-rich repeat 72..93 CDD:275378 7/20 (35%)
LRR_4 92..130 CDD:289563 13/40 (33%)
LRR 3 93..114 7/20 (35%)
leucine-rich repeat 94..115 CDD:275378 8/20 (40%)
LRR 4 115..135 5/22 (23%)
leucine-rich repeat 116..137 CDD:275378 5/23 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..323
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.