DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and Lrrc46

DIOPT Version :10

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_081302.2 Gene:Lrrc46 / 69297 MGIID:1916547 Length:323 Species:Mus musculus


Alignment Length:151 Identity:50/151 - (33%)
Similarity:80/151 - (52%) Gaps:5/151 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 EMLVNLRQL-FLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIE 231
            |.|:..|.| |.|...::: :...||..||.:.|....|..|.|||||.|:..||:..|.::.||
Mouse    23 EALITKRNLTFPGDEDLSE-KMFHTLGELETVRLDGEGITCIGNLEKLRNIHSLYLQSNKIQRIE 86

  Fly   232 NLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPL 296
            ||:..|.|..|.||:|:::.:.||..|:.|:.|.|:.|.::   .::|.::.::|..:.|..||.
Mouse    87 NLACITSLRFLSLARNQIRHVENLLDLQYLQFLDLSENLIE---TLKLDELPESLLILNLCGNPC 148

  Fly   297 AKDVRYRSKLRDILPQLQKID 317
            .....||..:...||.|..:|
Mouse   149 TNQEGYRKMVIGALPLLLDLD 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380
PPP1R42 44..208 CDD:455733 12/40 (30%)
leucine-rich repeat 63..84 CDD:275380
leucine-rich repeat 85..106 CDD:275380
leucine-rich repeat 107..128 CDD:275380
leucine-rich repeat 129..150 CDD:275380
PPP1R42 132..317 CDD:455733 49/149 (33%)
leucine-rich repeat 151..172 CDD:275380 2/3 (67%)
leucine-rich repeat 173..194 CDD:275380 6/21 (29%)
leucine-rich repeat 195..216 CDD:275380 10/20 (50%)
leucine-rich repeat 217..238 CDD:275380 7/20 (35%)
Lrrc46NP_081302.2 LRR 1 49..70 9/20 (45%)
leucine-rich repeat 50..71 CDD:275378 10/20 (50%)
PPP1R42 60..>146 CDD:455733 31/88 (35%)
LRR 2 71..92 8/20 (40%)
leucine-rich repeat 72..93 CDD:275378 7/20 (35%)
LRR 3 93..114 7/20 (35%)
leucine-rich repeat 94..115 CDD:275378 8/20 (40%)
LRR 4 115..135 5/22 (23%)
leucine-rich repeat 116..137 CDD:275378 5/23 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..323
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.