DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and Dnal1

DIOPT Version :9

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_006240414.1 Gene:Dnal1 / 685664 RGDID:1591349 Length:249 Species:Rattus norvegicus


Alignment Length:165 Identity:49/165 - (29%)
Similarity:82/165 - (49%) Gaps:28/165 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 LKKIE-NIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLAN-LRELYVS 223
            ::|:: ::..|.|..:|.|..|.|.||.||:.|.||.||||..|.|..:..||.:.: |.||::|
  Rat    96 IEKMDASLSTLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWIS 160

  Fly   224 ENGVETIENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQT 288
            .|.:|                   :||||..:.||::   |::::|.|.||.:...|.....|:.
  Rat   161 YNFIE-------------------KLKGIHVMRKLKI---LYISNNLVKDWAEFVKLAELPCLED 203

  Fly   289 IYLEYNPL----AKDVRYRSKLRDILPQLQKIDAT 319
            :....|||    :.:..:..:....:|:|:|:|.|
  Rat   204 LVFVGNPLEEKHSAEGNWIEEATKRVPKLKKLDGT 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380
LRR_8 61..117 CDD:290566
leucine-rich repeat 63..84 CDD:275380
LRR_4 83..125 CDD:289563
leucine-rich repeat 85..106 CDD:275380
LRR_8 105..183 CDD:290566 6/22 (27%)
leucine-rich repeat 107..128 CDD:275380
LRR_4 128..168 CDD:289563 1/7 (14%)
leucine-rich repeat 129..150 CDD:275380
LRR_4 149..189 CDD:289563 9/28 (32%)
leucine-rich repeat 151..172 CDD:275380 2/11 (18%)
leucine-rich repeat 173..194 CDD:275380 9/20 (45%)
LRR_8 194..249 CDD:290566 16/55 (29%)
LRR_4 194..235 CDD:289563 16/41 (39%)
leucine-rich repeat 195..216 CDD:275380 9/20 (45%)
leucine-rich repeat 217..238 CDD:275380 6/20 (30%)
Dnal1XP_006240414.1 LRR_4 108..148 CDD:289563 18/39 (46%)
leucine-rich repeat 109..129 CDD:275378 8/19 (42%)
LRR_8 129..186 CDD:290566 24/78 (31%)
leucine-rich repeat 131..175 CDD:275382 19/62 (31%)
LRR_4 154..192 CDD:289563 17/59 (29%)
leucine-rich repeat 176..199 CDD:275382 7/25 (28%)
leucine-rich repeat 201..231 CDD:275382 4/29 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.