DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and lrriq1

DIOPT Version :9

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_009291864.1 Gene:lrriq1 / 565257 ZFINID:ZDB-GENE-050419-235 Length:1511 Species:Danio rerio


Alignment Length:317 Identity:72/317 - (22%)
Similarity:150/317 - (47%) Gaps:25/317 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ADRAMNEPEAAKTVSGIQVIPAEDVASIEDIITIDPDCYELDLNHRRIEKLENFEPLTRIERLFL 68
            ::.|:.:..|:.::..:..:..||:          |.|           .|.......:::.|.|
Zfish   676 SEDAILKAGASNSLKQVTTVMLEDL----------PGC-----------SLSTLSECNKLQTLTL 719

  Fly    69 RWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVY 133
            |...:..::.|:....:..:::.:|.||.:: .:.|..|::|.:..|:|..|..||:...|:.:.
Zfish   720 RRCGLTSLDGLNQCSQIRYIDVQENSITHVD-CEGLSSLQILLLGRNQLMNIHGLDEAQNLQTLQ 783

  Fly   134 FVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEIL 198
            ...|.|:.|..|..|..|..|.:..|:|.....::.:..|..|....|.::.:|.|:....|..|
Zfish   784 LSHNNISLISGLGALKMLLHLSVDHNQLLSTRGLKEIYTLLHLDCSYNYLSHVEGLENCALLNTL 848

  Fly   199 SLQANRIVKIENLEKLANLRELYVSENGVETIENLSEN--TKLETLDLAKNRLKGIANLEKLELL 261
            .|:.|.:.::..|:....||:||:.:|.:.::::|...  ..|:.|.:.:|.:..::.|..|..|
Zfish   849 DLKGNSLTELPVLQNHVLLRDLYLDDNLIPSLDDLKSYWLPLLQNLSVVQNSITHLSPLLDLVSL 913

  Fly   262 EELWLNHNGVDDWKDIEL-LKVNKALQTIYLEYNPLAKDVRYRSKLRDILPQLQKID 317
            :.|.::||.:.|.:|:.| |:...:||.:.|..|||.::..:||.:.:.:|.|.|::
Zfish   914 KTLDVSHNCLSDLQDLCLNLQECSSLQELSLTVNPLLQENNWRSLILETVPGLIKLN 970

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380 1/18 (6%)
LRR_8 61..117 CDD:290566 11/55 (20%)
leucine-rich repeat 63..84 CDD:275380 4/20 (20%)
LRR_4 83..125 CDD:289563 10/41 (24%)
leucine-rich repeat 85..106 CDD:275380 4/20 (20%)
LRR_8 105..183 CDD:290566 20/77 (26%)
leucine-rich repeat 107..128 CDD:275380 7/20 (35%)
LRR_4 128..168 CDD:289563 10/39 (26%)
leucine-rich repeat 129..150 CDD:275380 6/20 (30%)
LRR_4 149..189 CDD:289563 8/39 (21%)
leucine-rich repeat 151..172 CDD:275380 4/20 (20%)
leucine-rich repeat 173..194 CDD:275380 5/20 (25%)
LRR_8 194..249 CDD:290566 14/56 (25%)
LRR_4 194..235 CDD:289563 11/40 (28%)
leucine-rich repeat 195..216 CDD:275380 5/20 (25%)
leucine-rich repeat 217..238 CDD:275380 6/22 (27%)
lrriq1XP_009291864.1 LRR_RI 713..952 CDD:238064 60/239 (25%)
LRR_8 713..767 CDD:290566 11/54 (20%)
leucine-rich repeat 714..735 CDD:275380 4/20 (20%)
leucine-rich repeat 736..756 CDD:275380 4/20 (20%)
LRR_8 755..811 CDD:290566 16/55 (29%)
leucine-rich repeat 757..778 CDD:275380 7/20 (35%)
leucine-rich repeat 779..800 CDD:275380 6/20 (30%)
leucine-rich repeat 801..822 CDD:275380 4/20 (20%)
leucine-rich repeat 823..844 CDD:275380 5/20 (25%)
leucine-rich repeat 845..866 CDD:275380 5/20 (25%)
LRR_8 867..921 CDD:290566 13/53 (25%)
leucine-rich repeat 867..890 CDD:275380 6/22 (27%)
leucine-rich repeat 891..912 CDD:275380 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.