Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_690381.2 | Gene: | lrrcc1 / 561887 | ZFINID: | ZDB-GENE-041111-207 | Length: | 997 | Species: | Danio rerio |
Alignment Length: | 247 | Identity: | 71/247 - (28%) |
---|---|---|---|
Similarity: | 113/247 - (45%) | Gaps: | 57/247 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 LIKKIENLSSL------KTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLE 130
Fly 131 KVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFL-GKNKIAKIENLDTLVN 194
Fly 195 LEILSLQANRIVKIENLEK----LANLRELYVSENGVE------------TIENLSENTKLETLD 243
Fly 244 -------LAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQT 288 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | |
LRR_8 | 61..117 | CDD:290566 | 19/50 (38%) | ||
leucine-rich repeat | 63..84 | CDD:275380 | 6/17 (35%) | ||
LRR_4 | 83..125 | CDD:289563 | 16/41 (39%) | ||
leucine-rich repeat | 85..106 | CDD:275380 | 8/20 (40%) | ||
LRR_8 | 105..183 | CDD:290566 | 28/78 (36%) | ||
leucine-rich repeat | 107..128 | CDD:275380 | 8/20 (40%) | ||
LRR_4 | 128..168 | CDD:289563 | 15/39 (38%) | ||
leucine-rich repeat | 129..150 | CDD:275380 | 8/20 (40%) | ||
LRR_4 | 149..189 | CDD:289563 | 11/40 (28%) | ||
leucine-rich repeat | 151..172 | CDD:275380 | 5/20 (25%) | ||
leucine-rich repeat | 173..194 | CDD:275380 | 4/21 (19%) | ||
LRR_8 | 194..249 | CDD:290566 | 18/77 (23%) | ||
LRR_4 | 194..235 | CDD:289563 | 13/56 (23%) | ||
leucine-rich repeat | 195..216 | CDD:275380 | 7/24 (29%) | ||
leucine-rich repeat | 217..238 | CDD:275380 | 5/32 (16%) | ||
lrrcc1 | XP_690381.2 | LRR_4 | 23..65 | CDD:289563 | 16/41 (39%) |
leucine-rich repeat | 25..46 | CDD:275378 | 8/20 (40%) | ||
LRR_8 | 46..101 | CDD:290566 | 24/54 (44%) | ||
LRR_4 | 46..87 | CDD:289563 | 15/40 (38%) | ||
leucine-rich repeat | 47..68 | CDD:275378 | 8/20 (40%) | ||
LRR_4 | 68..107 | CDD:289563 | 15/38 (39%) | ||
leucine-rich repeat | 69..90 | CDD:275378 | 8/20 (40%) | ||
LRR_8 | 89..149 | CDD:290566 | 20/78 (26%) | ||
LRR_4 | 89..133 | CDD:289563 | 16/62 (26%) | ||
leucine-rich repeat | 91..116 | CDD:275378 | 9/43 (21%) | ||
leucine-rich repeat | 117..129 | CDD:275378 | 5/11 (45%) | ||
Rootletin | 754..>869 | CDD:291694 | |||
DUF342 | <817..895 | CDD:302792 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |