| Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_021330922.1 | Gene: | lrguk / 559670 | ZFINID: | ZDB-GENE-050419-232 | Length: | 739 | Species: | Danio rerio |
| Alignment Length: | 272 | Identity: | 85/272 - (31%) |
|---|---|---|---|
| Similarity: | 130/272 - (47%) | Gaps: | 27/272 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 73 IKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSN 137
Fly 138 RITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQA 202
Fly 203 NRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKN---RLKGIANLEKLELLEEL 264
Fly 265 WLNHNGVDDWKDI---------ELLKVNKALQTIYLE--------YNPLAKDVRYRSKLRDILPQ 312
Fly 313 LQK----IDATL 320 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | |
| LRR_8 | 61..117 | CDD:290566 | 14/43 (33%) | ||
| leucine-rich repeat | 63..84 | CDD:275380 | 2/10 (20%) | ||
| LRR_4 | 83..125 | CDD:289563 | 14/41 (34%) | ||
| leucine-rich repeat | 85..106 | CDD:275380 | 6/20 (30%) | ||
| LRR_8 | 105..183 | CDD:290566 | 25/77 (32%) | ||
| leucine-rich repeat | 107..128 | CDD:275380 | 7/20 (35%) | ||
| LRR_4 | 128..168 | CDD:289563 | 12/39 (31%) | ||
| leucine-rich repeat | 129..150 | CDD:275380 | 6/20 (30%) | ||
| LRR_4 | 149..189 | CDD:289563 | 13/39 (33%) | ||
| leucine-rich repeat | 151..172 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 173..194 | CDD:275380 | 9/20 (45%) | ||
| LRR_8 | 194..249 | CDD:290566 | 21/57 (37%) | ||
| LRR_4 | 194..235 | CDD:289563 | 17/40 (43%) | ||
| leucine-rich repeat | 195..216 | CDD:275380 | 11/20 (55%) | ||
| leucine-rich repeat | 217..238 | CDD:275380 | 5/20 (25%) | ||
| lrguk | XP_021330922.1 | LRR | <25..>247 | CDD:227223 | 67/198 (34%) |
| leucine-rich repeat | 61..82 | CDD:275380 | 6/20 (30%) | ||
| leucine-rich repeat | 83..104 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 105..126 | CDD:275380 | 6/20 (30%) | ||
| leucine-rich repeat | 127..148 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 149..168 | CDD:275380 | 8/18 (44%) | ||
| leucine-rich repeat | 170..191 | CDD:275380 | 11/20 (55%) | ||
| leucine-rich repeat | 192..210 | CDD:275380 | 5/17 (29%) | ||
| leucine-rich repeat | 211..238 | CDD:275380 | 8/26 (31%) | ||
| GMPK | 326..449 | CDD:238026 | |||
| Herpes_ICP4_C | 520..>739 | CDD:332854 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||