Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001036219.1 | Gene: | lrrc61 / 553439 | ZFINID: | ZDB-GENE-060616-245 | Length: | 260 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 51/205 - (24%) |
---|---|---|---|
Similarity: | 77/205 - (37%) | Gaps: | 68/205 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 129 LEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLV 193
Fly 194 NLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLEKL 258
Fly 259 ELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKLRDILPQLQKIDA----- 318
Fly 319 ------TLCK 322 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | |
LRR_8 | 61..117 | CDD:290566 | |||
leucine-rich repeat | 63..84 | CDD:275380 | |||
LRR_4 | 83..125 | CDD:289563 | |||
leucine-rich repeat | 85..106 | CDD:275380 | |||
LRR_8 | 105..183 | CDD:290566 | 14/53 (26%) | ||
leucine-rich repeat | 107..128 | CDD:275380 | |||
LRR_4 | 128..168 | CDD:289563 | 8/38 (21%) | ||
leucine-rich repeat | 129..150 | CDD:275380 | 4/20 (20%) | ||
LRR_4 | 149..189 | CDD:289563 | 11/39 (28%) | ||
leucine-rich repeat | 151..172 | CDD:275380 | 4/20 (20%) | ||
leucine-rich repeat | 173..194 | CDD:275380 | 7/20 (35%) | ||
LRR_8 | 194..249 | CDD:290566 | 15/54 (28%) | ||
LRR_4 | 194..235 | CDD:289563 | 15/40 (38%) | ||
leucine-rich repeat | 195..216 | CDD:275380 | 9/20 (45%) | ||
leucine-rich repeat | 217..238 | CDD:275380 | 6/20 (30%) | ||
lrrc61 | NP_001036219.1 | leucine-rich repeat | 54..81 | CDD:275378 | 9/26 (35%) |
leucine-rich repeat | 98..122 | CDD:275378 | 8/36 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |