Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001006054.1 | Gene: | lrrc23 / 450033 | ZFINID: | ZDB-GENE-041010-153 | Length: | 326 | Species: | Danio rerio |
Alignment Length: | 238 | Identity: | 71/238 - (29%) |
---|---|---|---|
Similarity: | 116/238 - (48%) | Gaps: | 8/238 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 IELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIEN--LDML 148
Fly 149 TNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLD--TLVNLEILSLQANRIVKIENL 211
Fly 212 EKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLE-KLELLEELWLNHNGVDDWK 275
Fly 276 DIE-LLKVNKALQTIYLEYNPLAKDVRYRSKLRDILPQLQKID 317 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | |
LRR_8 | 61..117 | CDD:290566 | 10/30 (33%) | ||
leucine-rich repeat | 63..84 | CDD:275380 | |||
LRR_4 | 83..125 | CDD:289563 | 12/38 (32%) | ||
leucine-rich repeat | 85..106 | CDD:275380 | 4/19 (21%) | ||
LRR_8 | 105..183 | CDD:290566 | 24/79 (30%) | ||
leucine-rich repeat | 107..128 | CDD:275380 | 8/20 (40%) | ||
LRR_4 | 128..168 | CDD:289563 | 11/41 (27%) | ||
leucine-rich repeat | 129..150 | CDD:275380 | 6/22 (27%) | ||
LRR_4 | 149..189 | CDD:289563 | 10/39 (26%) | ||
leucine-rich repeat | 151..172 | CDD:275380 | 4/20 (20%) | ||
leucine-rich repeat | 173..194 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 194..249 | CDD:290566 | 19/54 (35%) | ||
LRR_4 | 194..235 | CDD:289563 | 14/40 (35%) | ||
leucine-rich repeat | 195..216 | CDD:275380 | 5/20 (25%) | ||
leucine-rich repeat | 217..238 | CDD:275380 | 7/20 (35%) | ||
lrrc23 | NP_001006054.1 | leucine-rich repeat | 64..83 | CDD:275380 | 4/18 (22%) |
LRR_4 | 65..102 | CDD:289563 | 12/36 (33%) | ||
LRR_8 | 83..140 | CDD:290566 | 19/56 (34%) | ||
leucine-rich repeat | 84..105 | CDD:275380 | 8/20 (40%) | ||
leucine-rich repeat | 106..129 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 130..150 | CDD:275380 | 4/19 (21%) | ||
LRR_8 | 149..206 | CDD:290566 | 20/58 (34%) | ||
leucine-rich repeat | 151..174 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 175..195 | CDD:275380 | 5/20 (25%) | ||
LRR_8 | 194..251 | CDD:290566 | 19/56 (34%) | ||
LRR_4 | 194..235 | CDD:289563 | 14/40 (35%) | ||
leucine-rich repeat | 196..217 | CDD:275380 | 7/20 (35%) | ||
LRR_4 | 216..258 | CDD:289563 | 11/41 (27%) | ||
leucine-rich repeat | 218..240 | CDD:275380 | 7/21 (33%) | ||
leucine-rich repeat | 241..262 | CDD:275380 | 5/20 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG54194 | |
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |