DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and dnaaf11

DIOPT Version :10

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001002311.2 Gene:dnaaf11 / 432388 ZFINID:ZDB-GENE-040827-2 Length:440 Species:Danio rerio


Alignment Length:131 Identity:51/131 - (38%)
Similarity:73/131 - (55%) Gaps:1/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 NLDTLVNLEILSLQANRIVKIENLEK-LANLRELYVSENGVETIENLSENTKLETLDLAKNRLKG 251
            |...:.:||.|||....|.:||::.| ..:|:.||:..|.:..|||:....|||.|:||.|.::.
Zfish    16 NNGEIFSLEELSLHQQDIQRIEHIHKWCRDLKILYLQNNLIPKIENVGRLKKLEYLNLALNNIEV 80

  Fly   252 IANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKLRDILPQLQKI 316
            |.|||..|.|::|.|..|.|.....:|.||.|..|:.:||..||.|:...||..:...:||||.:
Zfish    81 IENLEGCESLQKLDLTVNFVGRLSSVETLKHNLHLKELYLVGNPCAEYHGYRQYVVATVPQLQSL 145

  Fly   317 D 317
            |
Zfish   146 D 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380
PPP1R42 44..208 CDD:455733 7/19 (37%)
leucine-rich repeat 63..84 CDD:275380
leucine-rich repeat 85..106 CDD:275380
leucine-rich repeat 107..128 CDD:275380
leucine-rich repeat 129..150 CDD:275380
PPP1R42 132..317 CDD:455733 50/129 (39%)
leucine-rich repeat 151..172 CDD:275380
leucine-rich repeat 173..194 CDD:275380 1/5 (20%)
leucine-rich repeat 195..216 CDD:275380 9/21 (43%)
leucine-rich repeat 217..238 CDD:275380 7/20 (35%)
dnaaf11NP_001002311.2 LRR 1 20..43 9/22 (41%)
LRR 2 44..65 7/20 (35%)
LRR 3 66..89 11/22 (50%)
LRR 4 90..110 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..267
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..440
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.