DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and lum

DIOPT Version :9

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001002059.1 Gene:lum / 415149 ZFINID:ZDB-GENE-040625-24 Length:344 Species:Danio rerio


Alignment Length:317 Identity:94/317 - (29%)
Similarity:144/317 - (45%) Gaps:74/317 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PAEDVASIEDIITIDPDCYE-----------LDLNHRRIEKLENFEPL--TRIERLFLRWNLIKK 75
            |.|.|:|        |.|.:           :..|.|.::    |.|:  |.|:.|:|:.|.|::
Zfish    32 PLEGVSS--------PSCAQECECPINFPTAMYCNERNLK----FIPIVPTGIKYLYLQNNFIEE 84

  Fly    76 I-----ENLSSLKTLIELELYDNQIT--KIE--NLDDLPHLEVLDISFNRLTKIE-NLDKLVKLE 130
            |     :|.:.|:.|:   |.:|.||  ||:  .:|.|..||.|..|.|:|||.. :|.|  .|:
Zfish    85 IKAGVFDNATDLRWLV---LDNNNITSDKIQAGTIDKLGSLEKLLFSHNKLTKPPGSLSK--SLD 144

  Fly   131 KVYFVSNRITQI--ENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFL---GKNKIAKIENLD 190
            ::..:.|::|..  ..|..:.|||.:.|..|||...........|:.|.|   .:||:.|   |.
Zfish   145 ELKLIGNKLTSFPANTLAGMENLTTVHLSKNKLTTESLTGAFKGLKSLILLDVSENKLKK---LP 206

  Fly   191 TLVNLEILSLQA--NRIVKIEN--LEKLANLRELYVSEN---------GVETIENLSENTKLETL 242
            :.|...:|.|.|  |.|..|.|  |.||..|:.|.:|.|         ||..:.:|.|      |
Zfish   207 SGVPASLLMLYADNNDIDSIPNGYLAKLPLLQYLRISHNKLVDSGVPAGVFNVSSLLE------L 265

  Fly   243 DLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLK----VN-KALQTIYLEYN 294
            ||:.|:||.|..:.  |.||.|:|..|.::.::...:.:    || ..|:|:.|:.|
Zfish   266 DLSFNKLKTIPEIN--ESLEHLYLQVNEINKFELTNICRFSSPVNYSRLRTLRLDGN 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380 4/31 (13%)
LRR_8 61..117 CDD:290566 23/64 (36%)
leucine-rich repeat 63..84 CDD:275380 8/25 (32%)
LRR_4 83..125 CDD:289563 18/46 (39%)
leucine-rich repeat 85..106 CDD:275380 9/24 (38%)
LRR_8 105..183 CDD:290566 25/83 (30%)
leucine-rich repeat 107..128 CDD:275380 10/21 (48%)
LRR_4 128..168 CDD:289563 11/41 (27%)
leucine-rich repeat 129..150 CDD:275380 4/22 (18%)
LRR_4 149..189 CDD:289563 13/42 (31%)
leucine-rich repeat 151..172 CDD:275380 6/20 (30%)
leucine-rich repeat 173..194 CDD:275380 7/23 (30%)
LRR_8 194..249 CDD:290566 22/67 (33%)
LRR_4 194..235 CDD:289563 17/53 (32%)
leucine-rich repeat 195..216 CDD:275380 10/24 (42%)
leucine-rich repeat 217..238 CDD:275380 8/29 (28%)
lumNP_001002059.1 LRRNT 41..68 CDD:279764 5/30 (17%)
LRR_RI 58..274 CDD:238064 74/233 (32%)
LRR_8 70..132 CDD:290566 23/64 (36%)
leucine-rich repeat 72..95 CDD:275380 7/22 (32%)
leucine-rich repeat 96..121 CDD:275380 10/27 (37%)
LRR_8 121..177 CDD:290566 19/57 (33%)
leucine-rich repeat 122..142 CDD:275380 10/21 (48%)
leucine-rich repeat 143..166 CDD:275380 4/22 (18%)
LRR_8 166..247 CDD:290566 29/83 (35%)
leucine-rich repeat 167..191 CDD:275380 7/23 (30%)
leucine-rich repeat 192..212 CDD:275380 7/22 (32%)
leucine-rich repeat 213..236 CDD:275380 10/22 (45%)
LRR_8 235..292 CDD:290566 21/64 (33%)
leucine-rich repeat 237..261 CDD:275380 6/23 (26%)
leucine-rich repeat 282..311 CDD:275380 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D968788at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.