DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and LUM

DIOPT Version :9

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_002336.1 Gene:LUM / 4060 HGNCID:6724 Length:338 Species:Homo sapiens


Alignment Length:316 Identity:78/316 - (24%)
Similarity:134/316 - (42%) Gaps:87/316 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DVASIEDIITIDPDCYELDLNHRRIEKLEN--FEPLTRIERLFLRWNLIK--KIEN--LSSLKTL 85
            |...::.:..:.|....|.|.:.:|:.::.  ||.:|.::.|.|..||::  ||:.  .|.||.|
Human    54 DELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQL 118

  Fly    86 IELELYDNQITKIENLDDLP-HLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDM-- 147
            .:|.:..|.:|  |::..|| .||.|.::.|::||:.:.:.||.|..::...||:.:    |.  
Human   119 KKLHINHNNLT--ESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKE----DAVS 177

  Fly   148 -----LTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKI--ENLDTLVNLEILSLQANRI 205
                 |.:|..|:|..|::.::.: .:.|:|..|:|..|||:.|  |.......|:.|.|..|.:
Human   178 AAFKGLKSLEYLDLSFNQIARLPS-GLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNEL 241

  Fly   206 VKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNG 270
                             :::|:.  .|....:.|..|||:.|:||.|..                
Human   242 -----------------ADSGIP--GNSFNVSSLVELDLSYNKLKNIPT---------------- 271

  Fly   271 VDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKLRDILPQLQKID-ATLCKVPG 325
                       ||:.|:..|||.|                 ||:|.| .:.||:.|
Human   272 -----------VNENLENYYLEVN-----------------QLEKFDIKSFCKILG 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380 5/20 (25%)
LRR_8 61..117 CDD:290566 21/60 (35%)
leucine-rich repeat 63..84 CDD:275380 8/24 (33%)
LRR_4 83..125 CDD:289563 14/42 (33%)
leucine-rich repeat 85..106 CDD:275380 7/21 (33%)
LRR_8 105..183 CDD:290566 23/85 (27%)
leucine-rich repeat 107..128 CDD:275380 7/20 (35%)
LRR_4 128..168 CDD:289563 9/46 (20%)
leucine-rich repeat 129..150 CDD:275380 5/27 (19%)
LRR_4 149..189 CDD:289563 13/41 (32%)
leucine-rich repeat 151..172 CDD:275380 4/20 (20%)
leucine-rich repeat 173..194 CDD:275380 8/22 (36%)
LRR_8 194..249 CDD:290566 11/54 (20%)
LRR_4 194..235 CDD:289563 6/40 (15%)
leucine-rich repeat 195..216 CDD:275380 4/20 (20%)
leucine-rich repeat 217..238 CDD:275380 2/20 (10%)
LUMNP_002336.1 LRRNT 37..71 CDD:214470 2/16 (13%)
LRR 1 67..88 4/20 (20%)
inl_like_NEAT_1 <68..>310 CDD:411101 76/302 (25%)
leucine-rich repeat 68..91 CDD:275380 5/22 (23%)
LRR 2 91..114 6/22 (27%)
leucine-rich repeat 92..117 CDD:275380 8/24 (33%)
LRR 3 117..137 6/21 (29%)
leucine-rich repeat 118..138 CDD:275380 7/21 (33%)
LRR 4 138..159 6/20 (30%)
leucine-rich repeat 139..160 CDD:275380 7/20 (35%)
LRR 5 160..181 4/24 (17%)
leucine-rich repeat 161..185 CDD:275380 5/27 (19%)
LRR 6 185..205 4/20 (20%)
leucine-rich repeat 186..206 CDD:275380 4/20 (20%)
LRR 7 206..227 8/20 (40%)
leucine-rich repeat 207..230 CDD:275380 8/22 (36%)
LRR 8 230..253 6/41 (15%)
leucine-rich repeat 231..255 CDD:275380 6/42 (14%)
LRR 9 255..276 10/47 (21%)
leucine-rich repeat 276..305 CDD:275380 12/41 (29%)
LRR 10 277..296 8/35 (23%)
LRR 11 305..326
leucine-rich repeat 306..329 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D968788at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.