Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002336.1 | Gene: | LUM / 4060 | HGNCID: | 6724 | Length: | 338 | Species: | Homo sapiens |
Alignment Length: | 316 | Identity: | 78/316 - (24%) |
---|---|---|---|
Similarity: | 134/316 - (42%) | Gaps: | 87/316 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 DVASIEDIITIDPDCYELDLNHRRIEKLEN--FEPLTRIERLFLRWNLIK--KIEN--LSSLKTL 85
Fly 86 IELELYDNQITKIENLDDLP-HLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDM-- 147
Fly 148 -----LTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKI--ENLDTLVNLEILSLQANRI 205
Fly 206 VKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNG 270
Fly 271 VDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKLRDILPQLQKID-ATLCKVPG 325 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | 5/20 (25%) |
LRR_8 | 61..117 | CDD:290566 | 21/60 (35%) | ||
leucine-rich repeat | 63..84 | CDD:275380 | 8/24 (33%) | ||
LRR_4 | 83..125 | CDD:289563 | 14/42 (33%) | ||
leucine-rich repeat | 85..106 | CDD:275380 | 7/21 (33%) | ||
LRR_8 | 105..183 | CDD:290566 | 23/85 (27%) | ||
leucine-rich repeat | 107..128 | CDD:275380 | 7/20 (35%) | ||
LRR_4 | 128..168 | CDD:289563 | 9/46 (20%) | ||
leucine-rich repeat | 129..150 | CDD:275380 | 5/27 (19%) | ||
LRR_4 | 149..189 | CDD:289563 | 13/41 (32%) | ||
leucine-rich repeat | 151..172 | CDD:275380 | 4/20 (20%) | ||
leucine-rich repeat | 173..194 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 194..249 | CDD:290566 | 11/54 (20%) | ||
LRR_4 | 194..235 | CDD:289563 | 6/40 (15%) | ||
leucine-rich repeat | 195..216 | CDD:275380 | 4/20 (20%) | ||
leucine-rich repeat | 217..238 | CDD:275380 | 2/20 (10%) | ||
LUM | NP_002336.1 | LRRNT | 37..71 | CDD:214470 | 2/16 (13%) |
LRR 1 | 67..88 | 4/20 (20%) | |||
inl_like_NEAT_1 | <68..>310 | CDD:411101 | 76/302 (25%) | ||
leucine-rich repeat | 68..91 | CDD:275380 | 5/22 (23%) | ||
LRR 2 | 91..114 | 6/22 (27%) | |||
leucine-rich repeat | 92..117 | CDD:275380 | 8/24 (33%) | ||
LRR 3 | 117..137 | 6/21 (29%) | |||
leucine-rich repeat | 118..138 | CDD:275380 | 7/21 (33%) | ||
LRR 4 | 138..159 | 6/20 (30%) | |||
leucine-rich repeat | 139..160 | CDD:275380 | 7/20 (35%) | ||
LRR 5 | 160..181 | 4/24 (17%) | |||
leucine-rich repeat | 161..185 | CDD:275380 | 5/27 (19%) | ||
LRR 6 | 185..205 | 4/20 (20%) | |||
leucine-rich repeat | 186..206 | CDD:275380 | 4/20 (20%) | ||
LRR 7 | 206..227 | 8/20 (40%) | |||
leucine-rich repeat | 207..230 | CDD:275380 | 8/22 (36%) | ||
LRR 8 | 230..253 | 6/41 (15%) | |||
leucine-rich repeat | 231..255 | CDD:275380 | 6/42 (14%) | ||
LRR 9 | 255..276 | 10/47 (21%) | |||
leucine-rich repeat | 276..305 | CDD:275380 | 12/41 (29%) | ||
LRR 10 | 277..296 | 8/35 (23%) | |||
LRR 11 | 305..326 | ||||
leucine-rich repeat | 306..329 | CDD:275380 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D968788at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |