DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and cep97

DIOPT Version :9

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_009303333.2 Gene:cep97 / 386640 ZFINID:ZDB-GENE-031030-11 Length:631 Species:Danio rerio


Alignment Length:244 Identity:72/244 - (29%)
Similarity:115/244 - (47%) Gaps:25/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LDLNHRRIEKLEN--FEPLTRIERLFLRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPH 106
            |||:.|.:::||.  |.|.:....|.|..|.:.|:|:|.....|.:|.:..|::.::.|:..|..
Zfish    39 LDLSARGLQRLEPQLFRPDSHTHTLILDQNQLMKLEHLEHNPDLQQLSVACNRLVRMMNVCRLTQ 103

  Fly   107 LEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLV 171
            |.|||:..|.:..||.|.:|.:||::....|.|..:|.|....:|..|:|.||.:.:|.::..|.
Zfish   104 LRVLDLQNNSIGCIEGLKELQQLERLNLAGNNIKVMEQLHHCVSLQHLDLSDNNISQIGDVSRLS 168

  Fly   172 NLRQLFLGKNKIAKIENLDTLV--NLEILSLQANRIVKIENLEKLANLREL----YVSENGVETI 230
            .|:.|.|..|.|..:.:....:  :|.:|||..|.|..:..:..||.:|.|    .:|...|..:
Zfish   169 ALQTLLLHGNIITTLRSAPAHLPAHLRVLSLAENEIRDLTEVCYLAPVRGLQQLSLLSNPCVSCV 233

  Fly   231 EN---------LSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNG 270
            .:         ||....||.||       |:|..:| |.|:..||...|
Zfish   234 SSAVCDYRPYVLSWCLGLELLD-------GVAVTQK-EGLKAEWLYSQG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380 8/19 (42%)
LRR_8 61..117 CDD:290566 16/55 (29%)
leucine-rich repeat 63..84 CDD:275380 6/20 (30%)
LRR_4 83..125 CDD:289563 13/41 (32%)
leucine-rich repeat 85..106 CDD:275380 5/20 (25%)
LRR_8 105..183 CDD:290566 26/77 (34%)
leucine-rich repeat 107..128 CDD:275380 9/20 (45%)
LRR_4 128..168 CDD:289563 12/39 (31%)
leucine-rich repeat 129..150 CDD:275380 6/20 (30%)
LRR_4 149..189 CDD:289563 12/39 (31%)
leucine-rich repeat 151..172 CDD:275380 7/20 (35%)
leucine-rich repeat 173..194 CDD:275380 5/22 (23%)
LRR_8 194..249 CDD:290566 18/67 (27%)
LRR_4 194..235 CDD:289563 13/53 (25%)
leucine-rich repeat 195..216 CDD:275380 7/20 (35%)
leucine-rich repeat 217..238 CDD:275380 6/33 (18%)
cep97XP_009303333.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.