Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001020073.1 | Gene: | Lrrc56 / 365389 | RGDID: | 1311654 | Length: | 548 | Species: | Rattus norvegicus |
Alignment Length: | 198 | Identity: | 56/198 - (28%) |
---|---|---|---|
Similarity: | 93/198 - (46%) | Gaps: | 34/198 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 139 ITQIENLDMLTNLTMLELGDNKLKKIENIEM-LVNLRQLFLGKNKIAKIENLDT-LVNLEILSLQ 201
Fly 202 ANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLEKLEL---LEE 263
Fly 264 LWLNHNGVDDWKDIELLK-----VNKALQTIYLEYNPLAKDVRYRSKLRDILPQLQKIDATLCKV 323
Fly 324 PGT 326 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | |
LRR_8 | 61..117 | CDD:290566 | |||
leucine-rich repeat | 63..84 | CDD:275380 | |||
LRR_4 | 83..125 | CDD:289563 | |||
leucine-rich repeat | 85..106 | CDD:275380 | |||
LRR_8 | 105..183 | CDD:290566 | 13/44 (30%) | ||
leucine-rich repeat | 107..128 | CDD:275380 | |||
LRR_4 | 128..168 | CDD:289563 | 6/28 (21%) | ||
leucine-rich repeat | 129..150 | CDD:275380 | 2/10 (20%) | ||
LRR_4 | 149..189 | CDD:289563 | 11/40 (28%) | ||
leucine-rich repeat | 151..172 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 173..194 | CDD:275380 | 7/21 (33%) | ||
LRR_8 | 194..249 | CDD:290566 | 17/54 (31%) | ||
LRR_4 | 194..235 | CDD:289563 | 11/40 (28%) | ||
leucine-rich repeat | 195..216 | CDD:275380 | 3/20 (15%) | ||
leucine-rich repeat | 217..238 | CDD:275380 | 8/20 (40%) | ||
Lrrc56 | NP_001020073.1 | PPP1R42 | 91..233 | CDD:411060 | 46/163 (28%) |
LRR 1 | 94..115 | 7/20 (35%) | |||
leucine-rich repeat | 95..117 | CDD:275380 | 7/21 (33%) | ||
LRR 2 | 117..138 | 3/20 (15%) | |||
leucine-rich repeat | 118..139 | CDD:275380 | 3/20 (15%) | ||
LRR 3 | 139..160 | 8/20 (40%) | |||
leucine-rich repeat | 140..161 | CDD:275380 | 8/20 (40%) | ||
LRR 4 | 161..182 | 6/20 (30%) | |||
leucine-rich repeat | 162..186 | CDD:275380 | 8/23 (35%) | ||
LRR 5 | 186..206 | 6/26 (23%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 405..433 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |