DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and CG10839

DIOPT Version :10

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_609776.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster


Alignment Length:175 Identity:46/175 - (26%)
Similarity:81/175 - (46%) Gaps:31/175 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 TMLELG-DNKLKKIENIEMLVN----LRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENL 211
            |..|:| ..:...||.::.::|    .::|.|..|.|.||..:..:.||::|||..|.:..:..:
  Fly    24 TATEIGLQFQYPPIEKMDPILNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGI 88

  Fly   212 EKLAN-LRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWK 275
            |.||: |.||:||.|.:       |.||               .||.::.|...:::.|.:.||.
  Fly    89 EPLADTLEELWVSYNNI-------EKTK---------------PLESMKALRVFYISFNMIKDWT 131

  Fly   276 DIELLKVNKALQTIYLEYNPLAKDV---RYRSKLRDILPQLQKID 317
            :...:.|...|..|....|||.:::   .:.::....||.::|:|
  Fly   132 EFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMKKLD 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380
PPP1R42 44..208 CDD:455733 18/60 (30%)
leucine-rich repeat 63..84 CDD:275380
leucine-rich repeat 85..106 CDD:275380
leucine-rich repeat 107..128 CDD:275380
leucine-rich repeat 129..150 CDD:275380
PPP1R42 132..317 CDD:455733 45/173 (26%)
leucine-rich repeat 151..172 CDD:275380 5/20 (25%)
leucine-rich repeat 173..194 CDD:275380 6/20 (30%)
leucine-rich repeat 195..216 CDD:275380 7/20 (35%)
leucine-rich repeat 217..238 CDD:275380 7/20 (35%)
CG10839NP_609776.1 PPP1R42 <37..152 CDD:455733 37/136 (27%)
leucine-rich repeat 50..71 CDD:275380 6/20 (30%)
leucine-rich repeat 72..94 CDD:275380 8/21 (38%)
leucine-rich repeat 95..116 CDD:275380 11/42 (26%)
leucine-rich repeat 117..141 CDD:275380 5/23 (22%)
leucine-rich repeat 142..171 CDD:275380 6/28 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.