DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and CG9044

DIOPT Version :10

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001260114.1 Gene:CG9044 / 33825 FlyBaseID:FBgn0031752 Length:1318 Species:Drosophila melanogaster


Alignment Length:275 Identity:64/275 - (23%)
Similarity:117/275 - (42%) Gaps:67/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RAMNEPEAAK----TVSGIQ--------VIPAEDVASIEDIITIDPDCYELDLNHRRIEKLENFE 58
            ||:...|..|    .|.|||        :|..:.:.|::||||   .|...:.|.          
  Fly   111 RALRRLEVNKINIGQVVGIQPLRGQLQHLICVKSLTSVDDIIT---RCGGDNSNG---------- 162

  Fly    59 PLTRIERLFLRWNLIKKIE----NLSSLKTLIE-------LELYDNQITKIENLDDLPHLEVLDI 112
                    |: ||.:|..:    :|.|:.|.:|       |.|..|::|.:..:..||||:.||:
  Fly   163 --------FV-WNELKTADFSYNSLRSVDTALEFAQHLQHLNLRHNKLTSVAAIKWLPHLKTLDL 218

  Fly   113 SFNRLTKIE--NLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQ 175
            |:|.||.:.  :::...:|:.:...:|.:.::.::..|..|..|:|.||.|  :|:.::|     
  Fly   219 SYNCLTHLPQFHMEACKRLQLLNISNNYVEELLDVAKLDALYNLDLSDNCL--LEHSQLL----- 276

  Fly   176 LFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLE 240
                        .|..|::|.:|:||.|.:. .....:.|..:.|:.:...|:.:.:....||.|
  Fly   277 ------------PLSALMSLIVLNLQGNPLA-CNPKHRQATAQYLHKNSATVKFVLDFEPLTKAE 328

  Fly   241 TLDLAKNRLKGIANL 255
            .......:.:.|:.|
  Fly   329 KALTGSQKWRYISGL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380 1/18 (6%)
PPP1R42 44..208 CDD:455733 41/176 (23%)
leucine-rich repeat 63..84 CDD:275380 6/24 (25%)
leucine-rich repeat 85..106 CDD:275380 6/27 (22%)
leucine-rich repeat 107..128 CDD:275380 7/22 (32%)
leucine-rich repeat 129..150 CDD:275380 3/20 (15%)
PPP1R42 132..317 CDD:455733 25/124 (20%)
leucine-rich repeat 151..172 CDD:275380 8/20 (40%)
leucine-rich repeat 173..194 CDD:275380 2/20 (10%)
leucine-rich repeat 195..216 CDD:275380 5/20 (25%)
leucine-rich repeat 217..238 CDD:275380 2/20 (10%)
CG9044NP_001260114.1 LIP1 1..96 CDD:464931
leucine-rich repeat 168..190 CDD:275380 5/21 (24%)
PPP1R42 176..302 CDD:455733 36/145 (25%)
leucine-rich repeat 191..212 CDD:275380 5/20 (25%)
leucine-rich repeat 213..236 CDD:275380 7/22 (32%)
leucine-rich repeat 237..258 CDD:275380 3/20 (15%)
leucine-rich repeat 259..283 CDD:275380 10/42 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.